(data stored in ACNUC7421 zone)

EMBL: CP001743.PE408

CP001743.PE408       Location/Qualifiers
FT   CDS             complement(390915..392036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0413"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   InterPro IPR000160; KEGG: dvm:DvMF_2637 diguanylate cyclase
FT                   with extracellular sensor; COGs: COG2199 FOG: GGDEF domain;
FT                   SPTR: A6CMH3 Diguanylate cyclase (GGDEF domain); PFAM:
FT                   GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27190"
FT                   /protein_id="ADD27190.1"
FT                   /translation="MLPRPAPDPYVTLEVADPLETLRIRLTLWLLPLGAGAALTAWGLS
FT                   VTSNKLSLPDQYLLLPMAVGFIALEFHLWRNPQNVRWVWQIALALIAIYEIVSLFYEAA
FT                   YKLHQRDGITPAALWFPMVYLMAFNLLNRRQALRFSLVYLVLGLLAGAVGMLMSPSINV
FT                   SSINTALQFTFSNIAYLALLYMFAYLRRHYAQMHQMAHTDALTNLTNRRAMQQKLEGEL
FT                   DRARRYNRPFALLLADLDHFKQINDTYGHSVGDQVLREVAGRLAQHLRESDSLARWGGE
FT                   EFLILAPETDLQQAYLLAQRLLGAIRESPISGVQVTLSLGVACYRQGDSIAALLSRADE
FT                   AMYRAKAGGRNQIVLEEELEDIVIPSHSTTPEL"
     MLPRPAPDPY VTLEVADPLE TLRIRLTLWL LPLGAGAALT AWGLSVTSNK LSLPDQYLLL        60
     PMAVGFIALE FHLWRNPQNV RWVWQIALAL IAIYEIVSLF YEAAYKLHQR DGITPAALWF       120
     PMVYLMAFNL LNRRQALRFS LVYLVLGLLA GAVGMLMSPS INVSSINTAL QFTFSNIAYL       180
     ALLYMFAYLR RHYAQMHQMA HTDALTNLTN RRAMQQKLEG ELDRARRYNR PFALLLADLD       240
     HFKQINDTYG HSVGDQVLRE VAGRLAQHLR ESDSLARWGG EEFLILAPET DLQQAYLLAQ       300
     RLLGAIRESP ISGVQVTLSL GVACYRQGDS IAALLSRADE AMYRAKAGGR NQIVLEEELE       360
     DIVIPSHSTT PEL                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page