(data stored in ACNUC7421 zone)

EMBL: CP001743.PE412

CP001743.PE412       Location/Qualifiers
FT   CDS             394865..395422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0417"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; SPTR: A0YPZ6 Tripartite
FT                   ATP-independent periplasmic transporter, DctQ component;
FT                   InterPro IPR007387; COGs: COG4665 TRAP-type
FT                   mannitol/chloroaromatic compound transport system small
FT                   permease component; KEGG: tbd:Tbd_2150 TRAP transporter,
FT                   small subunit; PFAM: Tripartite ATP-independent periplasmic
FT                   transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27194"
FT                   /protein_id="ADD27194.1"
FT                   /translation="MKALLLIARLIDGLNEWVGRVTLWLVVPMIAIGAYNAIGRSLDKS
FT                   LGTRLASNTYFELQWYLFSLIFLLMVGYVLKHNGHIRVDVIYARLDDRGRAWVNMLGSI
FT                   LFVVPFAVLLFYVSLPLVAFSIQVREVSLDAGGLPRWPLKLMLLPAFVLLALQGLSEFI
FT                   KNLAYLRGALPRPPYEAEGEVA"
     MKALLLIARL IDGLNEWVGR VTLWLVVPMI AIGAYNAIGR SLDKSLGTRL ASNTYFELQW        60
     YLFSLIFLLM VGYVLKHNGH IRVDVIYARL DDRGRAWVNM LGSILFVVPF AVLLFYVSLP       120
     LVAFSIQVRE VSLDAGGLPR WPLKLMLLPA FVLLALQGLS EFIKNLAYLR GALPRPPYEA       180
     EGEVA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page