(data stored in ACNUC7421 zone)

EMBL: CP001743.PE419

CP001743.PE419       Location/Qualifiers
FT   CDS             402866..403525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet3506 hypothetical protein; SPTR:
FT                   A6FQE3 Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27201"
FT                   /protein_id="ADD27201.1"
FT                   /translation="MTRLDHLVLAAQTLQEGVEYVQDTLEVVLPPAGGRHPLMGTHNRL
FT                   LNLGGGVYLEIIAIDPQAPAPGRPRWFELDRFTGPPRLLTWVARTEALERYAALGLGPV
FT                   TKASRGDLEWHITLPEDGRLHWGGVVPYLIEWGARHPTDTLPDTGCRLLAWKLLHPQPG
FT                   AVAPVLQQLGLVYSLEVSFHPGLWALLQTPAGRKVLFSQAGGSAGRKTGPASPEIG"
     MTRLDHLVLA AQTLQEGVEY VQDTLEVVLP PAGGRHPLMG THNRLLNLGG GVYLEIIAID        60
     PQAPAPGRPR WFELDRFTGP PRLLTWVART EALERYAALG LGPVTKASRG DLEWHITLPE       120
     DGRLHWGGVV PYLIEWGARH PTDTLPDTGC RLLAWKLLHP QPGAVAPVLQ QLGLVYSLEV       180
     SFHPGLWALL QTPAGRKVLF SQAGGSAGRK TGPASPEIG                              219
//

If you have problems or comments...

PBIL Back to PBIL home page