(data stored in ACNUC7421 zone)

EMBL: CP001743.PE42

CP001743.PE42        Location/Qualifiers
FT   CDS             complement(36340..37152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0043"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A0ZJR0 Permease protein of
FT                   sugar ABC transporter; InterPro IPR000515; COGs: COG0395
FT                   ABC-type sugar transport system permease component; KEGG:
FT                   oan:Oant_2483 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26824"
FT                   /protein_id="ADD26824.1"
FT                   /translation="MKRLSTFLIYLLLTLGSLVMFFPFVWMFLTSLKPFAEIFELRLLP
FT                   QAPTLDNYREVLFDTQFPRWFLNSLIVAIITTASVLFFDSLVGYTLAKLRFPGKGFIFV
FT                   LILSTLMVPTEMLIIPWYVMSTEYGWSNTYWGLLFPGLISAFGVFLMRQFFDTLPTDLL
FT                   DAGRIDGLSEFGVFWRIAFPLVRPALAALGIFTFLGNWNAFLWPLIVVQTADMRTVPVG
FT                   VALFSSEAGTAWNLIMAASSLAVLPVLLVFLFFQRQIIEGVVLTGVKG"
     MKRLSTFLIY LLLTLGSLVM FFPFVWMFLT SLKPFAEIFE LRLLPQAPTL DNYREVLFDT        60
     QFPRWFLNSL IVAIITTASV LFFDSLVGYT LAKLRFPGKG FIFVLILSTL MVPTEMLIIP       120
     WYVMSTEYGW SNTYWGLLFP GLISAFGVFL MRQFFDTLPT DLLDAGRIDG LSEFGVFWRI       180
     AFPLVRPALA ALGIFTFLGN WNAFLWPLIV VQTADMRTVP VGVALFSSEA GTAWNLIMAA       240
     SSLAVLPVLL VFLFFQRQII EGVVLTGVKG                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page