(data stored in ACNUC7421 zone)

EMBL: CP001743.PE425

CP001743.PE425       Location/Qualifiers
FT   CDS             complement(407595..408050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0430"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; SPTR: A6BK61
FT                   Putative uncharacterized protein; InterPro IPR005302; COGs:
FT                   COG2258 conserved hypothetical protein; KEGG: sun:SUN_0055
FT                   hypothetical protein; PFAM: MOSC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27207"
FT                   /protein_id="ADD27207.1"
FT                   /translation="MPQLLSLHAGLAPSLPKPALLQVRLVEGQGVEGDRHFGRHPDRAV
FT                   LVAGQTSYAKAHQAGIELPWGALGENLLVDFDPHALGPHSRLKIGTAVLELTTVCTVCD
FT                   TLSAFDLRLPKVLYNARGVYARVLQGGLVRVGDPVEVLTPDSLLRMG"
     MPQLLSLHAG LAPSLPKPAL LQVRLVEGQG VEGDRHFGRH PDRAVLVAGQ TSYAKAHQAG        60
     IELPWGALGE NLLVDFDPHA LGPHSRLKIG TAVLELTTVC TVCDTLSAFD LRLPKVLYNA       120
     RGVYARVLQG GLVRVGDPVE VLTPDSLLRM G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page