(data stored in ACNUC7421 zone)

EMBL: CP001743.PE427

CP001743.PE427       Location/Qualifiers
FT   CDS             complement(408904..410133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0432"
FT                   /product="Sulfite oxidase"
FT                   /EC_number="1.8.3.1"
FT                   /note="PRIAM: Sulfite oxidase; PFAM: oxidoreductase
FT                   molybdopterin binding; Mo-co oxidoreductase dimerisation
FT                   domain; InterPro IPR008335:IPR000572:IPR005066:IPR006311;
FT                   KEGG: oca:OCAR_6288 twin-arginine translocation pathway
FT                   signal; COGs: COG2041 Sulfite oxidase; SPTR: A6AZ59
FT                   Twin-arginine translocation pathway signal; PFAM: TAT
FT                   (twin-arginine translocation) pathway signal sequence;
FT                   Oxidoreductase molybdopterin binding domain; Mo-co
FT                   oxidoreductase dimerisation domain; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27209"
FT                   /protein_id="ADD27209.1"
FT                   /translation="MKDKDLEQLEMDRRTFLKTTAAVGAAGLMGSSFAQQQPTADALVA
FT                   GKDRGLIVRNTNPIELETPVSLLRQNPITPKSVMYIRNNQPVPAGMTPTTDPPQVSDWT
FT                   VEVTGLVDRPTTLRLSQLRTLPATELEMVLQCSGNGRSFFSRYARASGAQWERGSMANV
FT                   RWKGVKLSSLLEAVGIKAEARFLTAEGADQPANPNAPDIERSIPLSDILANGMLVYEMN
FT                   GEPLPTIHGGPLRLIIPGYYGINNIKWVNKLRLEAAPSNNNTMIPRYRVPNNPIAVGSN
FT                   FQFTLENSRPNWRQNVKSVIFSPTEGEAVSGLIDVTGVAWNDGSAPITSVEVSTNQGRS
FT                   WQAATLERPSSPYGWYRWRIRVLVAAGDSEIWSRATDALGRSQPIDGAIFWNPNGYEWN
FT                   AVDKVKIRVG"
     MKDKDLEQLE MDRRTFLKTT AAVGAAGLMG SSFAQQQPTA DALVAGKDRG LIVRNTNPIE        60
     LETPVSLLRQ NPITPKSVMY IRNNQPVPAG MTPTTDPPQV SDWTVEVTGL VDRPTTLRLS       120
     QLRTLPATEL EMVLQCSGNG RSFFSRYARA SGAQWERGSM ANVRWKGVKL SSLLEAVGIK       180
     AEARFLTAEG ADQPANPNAP DIERSIPLSD ILANGMLVYE MNGEPLPTIH GGPLRLIIPG       240
     YYGINNIKWV NKLRLEAAPS NNNTMIPRYR VPNNPIAVGS NFQFTLENSR PNWRQNVKSV       300
     IFSPTEGEAV SGLIDVTGVA WNDGSAPITS VEVSTNQGRS WQAATLERPS SPYGWYRWRI       360
     RVLVAAGDSE IWSRATDALG RSQPIDGAIF WNPNGYEWNA VDKVKIRVG                   409
//

If you have problems or comments...

PBIL Back to PBIL home page