(data stored in ACNUC7421 zone)

EMBL: CP001743.PE429

CP001743.PE429       Location/Qualifiers
FT   CDS             complement(411864..414425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0434"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein;
FT                   InterProIPR007860:IPR000432:IPR007861:IPR007696:IPR
FT                   007695:IPR005748; KEGG: sus:Acid_4760 DNA mismatch repair
FT                   protein MutS; COGs: COG0249 Mismatch repair ATPase (MutS
FT                   family); SPTR: P61671 DNA mismatch repair protein mutS;
FT                   PFAM: MutS domain III; MutS domain V; MutS domain II; MutS
FT                   domain I; TIGRFAM: DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27211"
FT                   /protein_id="ADD27211.1"
FT                   /translation="MGSMTLKGQGPGPLPPLLEQYVELRDAYPDYLLLFQVGDFYEAFG
FT                   EDAERLSRALNLTLTHKTAKDFTTPMAGIPVRSVDVHLEKLLKLGFRVAVADQVELAEE
FT                   ADKLVRREVTQLLTPGTILRENLLKPEANYLAAISTGDGYGLALLDVSTGEFRGSVLYS
FT                   KSALYDELFRFRPAEVLLAPELYHHPAFLQEFQRRFPVMLSEEGFQDEVGKTALHKQFD
FT                   PLPAGLEHPALLRSAGAVLAYALRVQENGLPQVRSFVRYDPGAFMQLSEATLRTLEIFE
FT                   PSFVGDRSEERTLLGVLGLTRTAPGRRLLRAWLRHPLVEEAPLQARLDAVEALVKDGVL
FT                   RAEVRKVLYRMHDLERLAARLLAGRASPRDLAALQRSLALLPELAGLLAGVGPLFSLSE
FT                   RLPQPVAVAEQIAAALVEDPPLKITDGGLIREGFDPELDELRQRAEEGRAWIARLEGEA
FT                   REKTGIPNLKVGYNAVFGYYLEVTRPHYALVPKDWRALQTLKDRMRFSTPELKEQERKI
FT                   LQAETEAIKREYAVFLELREQVAQAADEVRQAAQVLAELDVYAALAEAAVEYGYSRPRF
FT                   SRDGTLQIVAGRHPVVERSSPFIPNDLSMSPAARLLILTGPNMAGKSTYLRQTALIALL
FT                   AQVGSFVPAESATLPLFDRIYTRIGASDDIAGGRSTFMVEMDELAGILQGATSKSLVLL
FT                   DEIGRGTSTYDGLALAWAACEYLHDQVRAYTLFATHYFELTALPLRMAAARNAHVAAKE
FT                   EAGGLVFYHQVLPGPASQSYGLEVARLAGLPQAVLQRARSVLDSLEASQKGLSKEILEE
FT                   LLQLDLARTSPLEALLFLRRLQDQLRGLAPQEAEAERLSQV"
     MGSMTLKGQG PGPLPPLLEQ YVELRDAYPD YLLLFQVGDF YEAFGEDAER LSRALNLTLT        60
     HKTAKDFTTP MAGIPVRSVD VHLEKLLKLG FRVAVADQVE LAEEADKLVR REVTQLLTPG       120
     TILRENLLKP EANYLAAIST GDGYGLALLD VSTGEFRGSV LYSKSALYDE LFRFRPAEVL       180
     LAPELYHHPA FLQEFQRRFP VMLSEEGFQD EVGKTALHKQ FDPLPAGLEH PALLRSAGAV       240
     LAYALRVQEN GLPQVRSFVR YDPGAFMQLS EATLRTLEIF EPSFVGDRSE ERTLLGVLGL       300
     TRTAPGRRLL RAWLRHPLVE EAPLQARLDA VEALVKDGVL RAEVRKVLYR MHDLERLAAR       360
     LLAGRASPRD LAALQRSLAL LPELAGLLAG VGPLFSLSER LPQPVAVAEQ IAAALVEDPP       420
     LKITDGGLIR EGFDPELDEL RQRAEEGRAW IARLEGEARE KTGIPNLKVG YNAVFGYYLE       480
     VTRPHYALVP KDWRALQTLK DRMRFSTPEL KEQERKILQA ETEAIKREYA VFLELREQVA       540
     QAADEVRQAA QVLAELDVYA ALAEAAVEYG YSRPRFSRDG TLQIVAGRHP VVERSSPFIP       600
     NDLSMSPAAR LLILTGPNMA GKSTYLRQTA LIALLAQVGS FVPAESATLP LFDRIYTRIG       660
     ASDDIAGGRS TFMVEMDELA GILQGATSKS LVLLDEIGRG TSTYDGLALA WAACEYLHDQ       720
     VRAYTLFATH YFELTALPLR MAAARNAHVA AKEEAGGLVF YHQVLPGPAS QSYGLEVARL       780
     AGLPQAVLQR ARSVLDSLEA SQKGLSKEIL EELLQLDLAR TSPLEALLFL RRLQDQLRGL       840
     APQEAEAERL SQV                                                          853
//

If you have problems or comments...

PBIL Back to PBIL home page