(data stored in ACNUC7421 zone)

EMBL: CP001743.PE430

CP001743.PE430       Location/Qualifiers
FT   CDS             complement(414486..414998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0435"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; InterPro
FT                   IPR001453:IPR008284; KEGG: afw:Anae109_1304 molybdenum
FT                   cofactor synthesis domain-containing protein; COGs: COG0521
FT                   Molybdopterin biosynthesis protein; SPTR: A3IN20
FT                   Molybdopterin biosynthesis protein; PFAM: Probable
FT                   molybdopterin binding domain; TIGRFAM: molybdenum cofactor
FT                   synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27212"
FT                   /protein_id="ADD27212.1"
FT                   /translation="MSESTAKHKEIARARGPVNLAIVTVSDTRTPETDTNYHYLKPEIE
FT                   ALGHRVVGYRIIKDEPEQVAQALEEMVQAGAQIILFNGGTGIAPRDTTYDVLARKIEKP
FT                   MPGFGELFRMLSYNEVGAAAMLSRATAGTYRRKVVFSTPGSPNAVKVAWEKLIKPELEH
FT                   LAWEVAR"
     MSESTAKHKE IARARGPVNL AIVTVSDTRT PETDTNYHYL KPEIEALGHR VVGYRIIKDE        60
     PEQVAQALEE MVQAGAQIIL FNGGTGIAPR DTTYDVLARK IEKPMPGFGE LFRMLSYNEV       120
     GAAAMLSRAT AGTYRRKVVF STPGSPNAVK VAWEKLIKPE LEHLAWEVAR                  170
//

If you have problems or comments...

PBIL Back to PBIL home page