(data stored in ACNUC7421 zone)

EMBL: CP001743.PE431

CP001743.PE431       Location/Qualifiers
FT   CDS             complement(415028..417448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0436"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.2"
FT                   /note="InterPro IPR002205:IPR006691:IPR005743; TIGRFAM: DNA
FT                   gyrase, A subunit; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); COGs: COG0188 Type IIA topoisomerase
FT                   (DNA gyrase/topo II topoisomerase IV) A subunit; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: P94605 DNA gyrase
FT                   subunit A; KEGG: bha:BH0007 DNA gyrase subunit A; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; PFAM: DNA gyrase/topoisomerase IV, subunit
FT                   A; DNA gyrase C-terminal domain, beta-propeller; TIGRFAM:
FT                   DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27213"
FT                   /protein_id="ADD27213.1"
FT                   /translation="MSQVLPVEITDEVKQSFINYAMSVIVDRALPDVRDGLKPVQRRIL
FT                   YGAYQDGVLPSRKHVKCAKIVGEVMGKFHPHGDAAIYDTLVRLAQPWNLRYPLIDGQGN
FT                   FGSVDGDPPAAQRYTEARLSNIGLELLQDLDKETVPFVPNYDGTQEQPEVLPAALPNLL
FT                   VNGSAGIAVGMATSLPPHNLGEVVDALVLMIDNPEVTLEEVMKVLPGPDFPTGAKLSRR
FT                   GIKEAYATGRGSLKVRARVRNEDKNGRAMLVFTEIPYQVNKADLIAQIASLVRNKVIDE
FT                   IAALRDESDRQGMRIAVELKRGANPQVVLNKLYKHSRLQTSFTVNLLAIVKGEPKVLTL
FT                   LELMRHYLDHRGLVVRKRTEYELRKARERAHVLEGLLIALDHIDEVIALIRGSQDAAEA
FT                   RAGLMGRFSLTEVQAQAILDMRLQRLVGLERDKLQAEYRELMEEIGRLEAILGDEKRLW
FT                   RVVRDELLAIKDKYGDQRRTQITEFEEGFSLEDLIEDEPMVITLTSQGFVKRTPLEAYR
FT                   AQGRGGMGAQAGKTKEEDEAISVFVASMHDTLLIFTNRGRVYGEKVHELPEASRQARGT
FT                   HIVSLLPLQEGEEVAALLNVRDLTQEGYFVFATKNGLIKKTEIKEYQNLSSAGLIAINL
FT                   LENDALVGVAIAQEGDQVMLATQSGQAIRFELSDVRATGRASQGVTGIRFKEGRDDRVV
FT                   SLVILPKGEESEVLAVGSHGYGKRTPISEYPLQGRGGMGVITFNTNEKVGQLAALMRVQ
FT                   GNEDLLVLSRRGNAIRTKVSSIAQYGRATSGVRVMNLSDKDEIASAFVIAPQD"
     MSQVLPVEIT DEVKQSFINY AMSVIVDRAL PDVRDGLKPV QRRILYGAYQ DGVLPSRKHV        60
     KCAKIVGEVM GKFHPHGDAA IYDTLVRLAQ PWNLRYPLID GQGNFGSVDG DPPAAQRYTE       120
     ARLSNIGLEL LQDLDKETVP FVPNYDGTQE QPEVLPAALP NLLVNGSAGI AVGMATSLPP       180
     HNLGEVVDAL VLMIDNPEVT LEEVMKVLPG PDFPTGAKLS RRGIKEAYAT GRGSLKVRAR       240
     VRNEDKNGRA MLVFTEIPYQ VNKADLIAQI ASLVRNKVID EIAALRDESD RQGMRIAVEL       300
     KRGANPQVVL NKLYKHSRLQ TSFTVNLLAI VKGEPKVLTL LELMRHYLDH RGLVVRKRTE       360
     YELRKARERA HVLEGLLIAL DHIDEVIALI RGSQDAAEAR AGLMGRFSLT EVQAQAILDM       420
     RLQRLVGLER DKLQAEYREL MEEIGRLEAI LGDEKRLWRV VRDELLAIKD KYGDQRRTQI       480
     TEFEEGFSLE DLIEDEPMVI TLTSQGFVKR TPLEAYRAQG RGGMGAQAGK TKEEDEAISV       540
     FVASMHDTLL IFTNRGRVYG EKVHELPEAS RQARGTHIVS LLPLQEGEEV AALLNVRDLT       600
     QEGYFVFATK NGLIKKTEIK EYQNLSSAGL IAINLLENDA LVGVAIAQEG DQVMLATQSG       660
     QAIRFELSDV RATGRASQGV TGIRFKEGRD DRVVSLVILP KGEESEVLAV GSHGYGKRTP       720
     ISEYPLQGRG GMGVITFNTN EKVGQLAALM RVQGNEDLLV LSRRGNAIRT KVSSIAQYGR       780
     ATSGVRVMNL SDKDEIASAF VIAPQD                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page