(data stored in ACNUC7421 zone)

EMBL: CP001743.PE432

CP001743.PE432       Location/Qualifiers
FT   CDS             417621..419183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0437"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; InterPro IPR000577:IPR005999; KEGG: gme:Gmet_1676
FT                   glycerol kinase; COGs: COG0554 Glycerol kinase; SPTR:
FT                   Q9RT38 Glycerol kinase; PFAM: FGGY family of carbohydrate
FT                   kinases, C-terminal domain; FGGY family of carbohydrate
FT                   kinases, N-terminal domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27214"
FT                   /protein_id="ADD27214.1"
FT                   /translation="MPGTALVLAGFGVFAISAIKTEESMPYILALDQGTTSSRAIVFDL
FT                   EGQPQAMAQQEFMQHFPQPGWVEHDPLEIWQTQLQVAQEAIQRAAIQPSEIVALGITNQ
FT                   RETTVLWERATGKPVHRAIVWQDRRTAPICDELRKGGYEGLFRQKTGLVLDAYFSGTKV
FT                   KWLLENVPGFRERAGKGELCFGTIDSWLIYNLTGGRVHATDVSNASRTLLFNLHTQRWD
FT                   EELLGILGLPKALLPEVRPSAGLFGETLPELFGAPIPIAGVAGDQQAALFGQACFTPGM
FT                   AKNTYGTGCFLLMHTGQEQVTSQNGLLTTVAWQLEGGPLEYALEGSVFVAGAVVQWLRD
FT                   GLGIIQNSSEIEHLARQVSSTDGVYLVPAFVGLGAPYWDPYARGTVVGLTRGSSKAHLA
FT                   RAALEAIAYQSRDVLEAMEADAGLQLSELRMDGGATVNDLLMQFQADILGTPVVRPQVT
FT                   ETTALGAAYLAGVGVGLLTQAQIAQRWAVQKRFEPAMGQEERARLYSGWKKAVERAKSW
FT                   VDA"
     MPGTALVLAG FGVFAISAIK TEESMPYILA LDQGTTSSRA IVFDLEGQPQ AMAQQEFMQH        60
     FPQPGWVEHD PLEIWQTQLQ VAQEAIQRAA IQPSEIVALG ITNQRETTVL WERATGKPVH       120
     RAIVWQDRRT APICDELRKG GYEGLFRQKT GLVLDAYFSG TKVKWLLENV PGFRERAGKG       180
     ELCFGTIDSW LIYNLTGGRV HATDVSNASR TLLFNLHTQR WDEELLGILG LPKALLPEVR       240
     PSAGLFGETL PELFGAPIPI AGVAGDQQAA LFGQACFTPG MAKNTYGTGC FLLMHTGQEQ       300
     VTSQNGLLTT VAWQLEGGPL EYALEGSVFV AGAVVQWLRD GLGIIQNSSE IEHLARQVSS       360
     TDGVYLVPAF VGLGAPYWDP YARGTVVGLT RGSSKAHLAR AALEAIAYQS RDVLEAMEAD       420
     AGLQLSELRM DGGATVNDLL MQFQADILGT PVVRPQVTET TALGAAYLAG VGVGLLTQAQ       480
     IAQRWAVQKR FEPAMGQEER ARLYSGWKKA VERAKSWVDA                             520
//

If you have problems or comments...

PBIL Back to PBIL home page