(data stored in ACNUC7421 zone)

EMBL: CP001743.PE433

CP001743.PE433       Location/Qualifiers
FT   CDS             419237..419575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to protein O-D-mannosyltransferase;
FT                   K00728 dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27215"
FT                   /protein_id="ADD27215.1"
FT                   /translation="MDFKELVNQAREAAENALKQAEAKFNEVKANLDKDGDGVPDQLEG
FT                   VMNQAKQAAEQAKAKFEELKASLDKDGDGVPDQLKSLGEQARQAAEQAKAKAEELARAA
FT                   QERLGKKS"
     MDFKELVNQA REAAENALKQ AEAKFNEVKA NLDKDGDGVP DQLEGVMNQA KQAAEQAKAK        60
     FEELKASLDK DGDGVPDQLK SLGEQARQAA EQAKAKAEEL ARAAQERLGK KS               112
//

If you have problems or comments...

PBIL Back to PBIL home page