(data stored in ACNUC7421 zone)

EMBL: CP001743.PE435

CP001743.PE435       Location/Qualifiers
FT   CDS             complement(420964..421542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27217"
FT                   /protein_id="ADD27217.1"
FT                   /translation="MTASVKHRLYSGLVYDDFSTLLDRILETIDEHHATNRELAVVKSA
FT                   LETAINRYASRPNLLEEIDHAYKALERKLNHFAQVGKPIKATAIREEIHELNDLLYFSE
FT                   QASNQIERLASKIIMLEKTRAIIRFKLAKMLELQQLILYISAARDTFAKIASQEQLDLL
FT                   EESLRREILNPLRLELLPLGVTTTRARVH"
     MTASVKHRLY SGLVYDDFST LLDRILETID EHHATNRELA VVKSALETAI NRYASRPNLL        60
     EEIDHAYKAL ERKLNHFAQV GKPIKATAIR EEIHELNDLL YFSEQASNQI ERLASKIIML       120
     EKTRAIIRFK LAKMLELQQL ILYISAARDT FAKIASQEQL DLLEESLRRE ILNPLRLELL       180
     PLGVTTTRAR VH                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page