(data stored in ACNUC7421 zone)

EMBL: CP001743.PE439

CP001743.PE439       Location/Qualifiers
FT   CDS             427690..428787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0444"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   SPTR: A6DG29 Filamentation induced by cAMP protein Fic;
FT                   InterPro IPR003812; COGs: COG3177 conserved hypothetical
FT                   protein; KEGG: bur:Bcep18194_B2094 filamentation induced by
FT                   cAMP protein Fic; PFAM: Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27221"
FT                   /protein_id="ADD27221.1"
FT                   /translation="MADSGFGPSDIVAERKALLERLGGLPATLLSVRNEEWLYMLQEDT
FT                   HHSLAIEGHFATEQQLKAVLQGRRSGPEIVNYFRTAQSLYDLALQYHLEGQTHLDLALI
FT                   RHIHSELWRDLAPDRGRFALNGEARVIQGAQVRPPVYDVEAYMRAFVRVTLELLRQYPI
FT                   LEALARSHTLFEAIHPFKDGNGRAGRILLSYLAINQGYVPIVIKGLHPEERNAYYQALE
FT                   AADRGFHQGFPPPKPPLLLERLEEGNFAPLVGLLLEGMLPRLDQTIALSLAARVPLLGL
FT                   EEVARALGVPRGTLYQWRKRGRLIVLKPQGRRAGLLSHPWLFLGTQDTPAQTPANFPPI
FT                   RENQAGQTMSLFEAVLQNPTDTRLE"
     MADSGFGPSD IVAERKALLE RLGGLPATLL SVRNEEWLYM LQEDTHHSLA IEGHFATEQQ        60
     LKAVLQGRRS GPEIVNYFRT AQSLYDLALQ YHLEGQTHLD LALIRHIHSE LWRDLAPDRG       120
     RFALNGEARV IQGAQVRPPV YDVEAYMRAF VRVTLELLRQ YPILEALARS HTLFEAIHPF       180
     KDGNGRAGRI LLSYLAINQG YVPIVIKGLH PEERNAYYQA LEAADRGFHQ GFPPPKPPLL       240
     LERLEEGNFA PLVGLLLEGM LPRLDQTIAL SLAARVPLLG LEEVARALGV PRGTLYQWRK       300
     RGRLIVLKPQ GRRAGLLSHP WLFLGTQDTP AQTPANFPPI RENQAGQTMS LFEAVLQNPT       360
     DTRLE                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page