(data stored in ACNUC7421 zone)

EMBL: CP001743.PE44

CP001743.PE44        Location/Qualifiers
FT   CDS             complement(38205..39449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0045"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   oan:Oant_2485 extracellular solute-binding protein family
FT                   1; SPTR: B5IRL8 Bacterial extracellular solute-binding
FT                   protein, putative; PFAM: extracellular solute-binding
FT                   protein family 1; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26826"
FT                   /protein_id="ADD26826.1"
FT                   /translation="MRKALFILTVLLGAALAQGQVTITYWQYDFKSKVEAVNELIKKFE
FT                   AANPGIKVLHQTFPFDAYQQKVASSIPAGQGPDVVNLFYGWLPTWVKAGYLQPLPAEYT
FT                   RVLDNEFSSLAQAAKVGGRLYGMPTAVRSLALFYNRDLLNAAGFKNPPKTWDEFLSIAA
FT                   KLTVKDGNRFSQLGYAMAPDGQDHHLVREVLVRQFGGRPYSDDGRRVLYGDAAGLRAFT
FT                   FYTDWFKKYNVGTLGNQFFPGNNAYRDAFIAGRVGMIVDGSFAIGTIRSGAKFNWGVAE
FT                   LPVEKVGGRKVNYGSFWMHGLTPLATGPKLAASLKFLEFLVSEETQRYWLEKVGELPAR
FT                   KSLIKDPKLTLDRIFGPFVLSLSYAKATPFVDEIGQRKVMTDAINRVLLENRDPAESWR
FT                   IAAAEEQKLLDAFWK"
     MRKALFILTV LLGAALAQGQ VTITYWQYDF KSKVEAVNEL IKKFEAANPG IKVLHQTFPF        60
     DAYQQKVASS IPAGQGPDVV NLFYGWLPTW VKAGYLQPLP AEYTRVLDNE FSSLAQAAKV       120
     GGRLYGMPTA VRSLALFYNR DLLNAAGFKN PPKTWDEFLS IAAKLTVKDG NRFSQLGYAM       180
     APDGQDHHLV REVLVRQFGG RPYSDDGRRV LYGDAAGLRA FTFYTDWFKK YNVGTLGNQF       240
     FPGNNAYRDA FIAGRVGMIV DGSFAIGTIR SGAKFNWGVA ELPVEKVGGR KVNYGSFWMH       300
     GLTPLATGPK LAASLKFLEF LVSEETQRYW LEKVGELPAR KSLIKDPKLT LDRIFGPFVL       360
     SLSYAKATPF VDEIGQRKVM TDAINRVLLE NRDPAESWRI AAAEEQKLLD AFWK             414
//

If you have problems or comments...

PBIL Back to PBIL home page