(data stored in ACNUC7421 zone)

EMBL: CP001743.PE440

CP001743.PE440       Location/Qualifiers
FT   CDS             428790..431840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0445"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SMART: helicase
FT                   domain protein; DEAD-like helicase; InterPro
FT                   IPR001650:IPR014001; KEGG: sfu:Sfum_0411 helicase domain
FT                   protein; SPTR: A5YS53 Helicase, C-terminal; PFAM: Helicase
FT                   conserved C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27222"
FT                   /protein_id="ADD27222.1"
FT                   /translation="MSANLQLPDFIDNDHLKLSEALNFLLRSQPQADIASGYFNLGGYA
FT                   LVKDALAEIPRLRILLSKEGGIAAGELYPAGFQKDLASAKFATRNRELAKELVQLLLRP
FT                   EIEVRLYTKGFFHGKAYIFGDVAIIGSSNFTHAGLTANTELNSVHKQGYAAQAAREWFE
FT                   RFWEQSQDYKLELVRLLEESKLISSGYSPYLIFLKSLYEYFKDELTVDLEKGRNIGKSL
FT                   VDLADFQQKAFERALKILEKYDGVFIADSVGLGKTWIGKKLLEHFGYFQRKKCLVIAPA
FT                   QLSQMWEDELRSIQVAAHVVSMESMGRSNFDASSYFDAEVVLVDESHNFRNSNQRYAAL
FT                   SRIMNAGRRKKAIMLTATPINNSVFDLYNQIMLFARGERYFARAGIPYLRGYFIRALED
FT                   GDLLNLLEEVMVRRTRQFVKQEFPEAVINGEPVRFPRRELHTERYDLEAIYPDLYKQVA
FT                   VRFEELILAAYNPEAFLERPTDKEELERQRNEALIGLIKSLLLKRFESSVEAFRISLRR
FT                   QIAFHERFIEELMHGHLLSSADYRRLIALENEEEVSSSVQSLPTVDASAYRVLELAQVA
FT                   AADLEHLREMLRMVEPVAVENDPKIAKLIELIRERPGKKIVVFSYFQDTIRYLEQAFRE
FT                   TYAESLQAVRWAVVDGSVRTKDRTDILRRFAPKSQKTQVAPEDELDLLLATDVFSEGQN
FT                   LQDADTLINFDLHWNPTRMIQRAGRIDRLGSPFEVIHIHNFFPEDGLEEMLGLLERLME
FT                   KIVQIDKNVGLDASILGEVINPKTFNALRRIEQEDARIADELEAEAEISSEFMRALLST
FT                   YLQKSGAERLEAIPYGVHSGMAGRGRRGIFFHFKVGDEHIWRFYDVDKREILDSKYRIY
FT                   NLIQCEEQTPRVDADYNVDDILAEVSRHLLEDLNIQNAVQVDTLPKAQREVLTALRGLA
FT                   RHPQIDRQELIELLKNLNQPLSRVLVRELESIHKAYEAQPMELVKALRAFVEHYYLTQT
FT                   DQSAQANRRFSEEDLELVVYLTLSATQ"
     MSANLQLPDF IDNDHLKLSE ALNFLLRSQP QADIASGYFN LGGYALVKDA LAEIPRLRIL        60
     LSKEGGIAAG ELYPAGFQKD LASAKFATRN RELAKELVQL LLRPEIEVRL YTKGFFHGKA       120
     YIFGDVAIIG SSNFTHAGLT ANTELNSVHK QGYAAQAARE WFERFWEQSQ DYKLELVRLL       180
     EESKLISSGY SPYLIFLKSL YEYFKDELTV DLEKGRNIGK SLVDLADFQQ KAFERALKIL       240
     EKYDGVFIAD SVGLGKTWIG KKLLEHFGYF QRKKCLVIAP AQLSQMWEDE LRSIQVAAHV       300
     VSMESMGRSN FDASSYFDAE VVLVDESHNF RNSNQRYAAL SRIMNAGRRK KAIMLTATPI       360
     NNSVFDLYNQ IMLFARGERY FARAGIPYLR GYFIRALEDG DLLNLLEEVM VRRTRQFVKQ       420
     EFPEAVINGE PVRFPRRELH TERYDLEAIY PDLYKQVAVR FEELILAAYN PEAFLERPTD       480
     KEELERQRNE ALIGLIKSLL LKRFESSVEA FRISLRRQIA FHERFIEELM HGHLLSSADY       540
     RRLIALENEE EVSSSVQSLP TVDASAYRVL ELAQVAAADL EHLREMLRMV EPVAVENDPK       600
     IAKLIELIRE RPGKKIVVFS YFQDTIRYLE QAFRETYAES LQAVRWAVVD GSVRTKDRTD       660
     ILRRFAPKSQ KTQVAPEDEL DLLLATDVFS EGQNLQDADT LINFDLHWNP TRMIQRAGRI       720
     DRLGSPFEVI HIHNFFPEDG LEEMLGLLER LMEKIVQIDK NVGLDASILG EVINPKTFNA       780
     LRRIEQEDAR IADELEAEAE ISSEFMRALL STYLQKSGAE RLEAIPYGVH SGMAGRGRRG       840
     IFFHFKVGDE HIWRFYDVDK REILDSKYRI YNLIQCEEQT PRVDADYNVD DILAEVSRHL       900
     LEDLNIQNAV QVDTLPKAQR EVLTALRGLA RHPQIDRQEL IELLKNLNQP LSRVLVRELE       960
     SIHKAYEAQP MELVKALRAF VEHYYLTQTD QSAQANRRFS EEDLELVVYL TLSATQ          1016
//

If you have problems or comments...

PBIL Back to PBIL home page