(data stored in ACNUC7421 zone)

EMBL: CP001743.PE447

CP001743.PE447       Location/Qualifiers
FT   CDS             complement(438717..439493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0452"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: undecaprenol kinase; PRIAM:
FT                   Undecaprenyl-diphosphatase; PFAM: Bacitracin resistance
FT                   protein BacA; InterPro IPR003824; KEGG: wsu:WS1290 putative
FT                   undecaprenol kinase bacitracin resistance protein; COGs:
FT                   COG1968 Uncharacterized bacitracin resistance protein;
FT                   SPTR: O67939 Undecaprenyl-diphosphatase; PFAM: Bacitracin
FT                   resistance protein BacA; TIGRFAM:
FT                   undecaprenyl-diphosphatase UppP"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27229"
FT                   /protein_id="ADD27229.1"
FT                   /translation="MTIFEALILGILEGLTEFLPISSTGHLTLAAHLLQLDIENDPFIK
FT                   SFIVVIQLGAILAVLALYFQRFLRDIEVWKRIIVAFIPTGILGFLLADVIENVFLGNDL
FT                   IVVINLVGVGILLLFVDRWLQHHKRYDDVNQMPVPHAVLIGLSQALAMMPGVSRSGATI
FT                   VGGMALGLSRRAAAEFSFILAVPTMLSATGFSLVRHMDQFRADSWGLLVVGFLAAFISA
FT                   LLTVRWLLDFVSRNSFVPFAIYRILIGVVYGVFFLR"
     MTIFEALILG ILEGLTEFLP ISSTGHLTLA AHLLQLDIEN DPFIKSFIVV IQLGAILAVL        60
     ALYFQRFLRD IEVWKRIIVA FIPTGILGFL LADVIENVFL GNDLIVVINL VGVGILLLFV       120
     DRWLQHHKRY DDVNQMPVPH AVLIGLSQAL AMMPGVSRSG ATIVGGMALG LSRRAAAEFS       180
     FILAVPTMLS ATGFSLVRHM DQFRADSWGL LVVGFLAAFI SALLTVRWLL DFVSRNSFVP       240
     FAIYRILIGV VYGVFFLR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page