(data stored in ACNUC7421 zone)

EMBL: CP001743.PE45

CP001743.PE45        Location/Qualifiers
FT   CDS             complement(39626..40051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0046"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; SPTR:
FT                   A7JPS5 Possible ATPase; InterPro IPR003442; COGs: COG0802
FT                   ATPase or kinase; KEGG: eba:ebA4453 hypothetical protein;
FT                   PFAM: Uncharacterised P-loop hydrolase UPF0079; TIGRFAM:
FT                   conserved hypothetical nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26827"
FT                   /protein_id="ADD26827.1"
FT                   /translation="MLLKHLEDTRSVAHRLAHSLPEGALVLLTGPMGAGKTTLVQFIAQ
FT                   ALGFRGEVTSPTYTLIHEYPSPQGLIVHIDAYRMADQEELFNLGLEDYLPEARLVLIEW
FT                   GKPEVFPDSLEIRLTPTEHGRRLELIPHGRASLPKLA"
     MLLKHLEDTR SVAHRLAHSL PEGALVLLTG PMGAGKTTLV QFIAQALGFR GEVTSPTYTL        60
     IHEYPSPQGL IVHIDAYRMA DQEELFNLGL EDYLPEARLV LIEWGKPEVF PDSLEIRLTP       120
     TEHGRRLELI PHGRASLPKL A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page