(data stored in ACNUC7421 zone)

EMBL: CP001743.PE451

CP001743.PE451       Location/Qualifiers
FT   CDS             442269..443798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0456"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A6ZIJ1 ABC transporter
FT                   permease protein; InterPro IPR000515; COGs: COG1178
FT                   ABC-type Fe3+ transport system permease component; KEGG:
FT                   cvi:CV_3162 thiamine transport system permease protein;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27233"
FT                   /protein_id="ADD27233.1"
FT                   /translation="MAKASRAASWLALPVLVFLALALLYPLGRIVALGLTEGFIATLGD
FT                   PYYRSRLLWSLAYGLGSSLLCIGMALPLAYAFRYRFPGRDFWLAFSVVPFVLPTLVVAM
FT                   GFLSLVGPRGLLGINLYDTPWILFWASLLYNLGLVLRPLVALLPMLSTPLQAARTLGAS
FT                   PIRAYLRVGIPLLTPALLSGGSLVFLFSFTSFGVPLLLGGPGWATLEVATYQALAQRLA
FT                   FPEASALVLMQLVVTGLVLWLYLRLQTGWVVGLEGAEAPLPLMRGRALALAIGVAGVFL
FT                   LLYSPLLALVWRALERPGAWLSVWRNPDFTPGLLALQNTLAFAGVALLGVLPVGFLYAY
FT                   AVWRGARWLDGLGLLPLMVSPVALGLGYLLVYPGLRGSIWLLIGAYILLSYPLLTRTLL
FT                   PALQGLPQGVLEAARVLGASPWRRFIGVEWPLVRPSTTAGLALALAAILGEFGATLTLQ
FT                   RPEWATLSLAIYERLGRPGATPFYEAVVLAVALMALCTVLLLGLQKGTWER"
     MAKASRAASW LALPVLVFLA LALLYPLGRI VALGLTEGFI ATLGDPYYRS RLLWSLAYGL        60
     GSSLLCIGMA LPLAYAFRYR FPGRDFWLAF SVVPFVLPTL VVAMGFLSLV GPRGLLGINL       120
     YDTPWILFWA SLLYNLGLVL RPLVALLPML STPLQAARTL GASPIRAYLR VGIPLLTPAL       180
     LSGGSLVFLF SFTSFGVPLL LGGPGWATLE VATYQALAQR LAFPEASALV LMQLVVTGLV       240
     LWLYLRLQTG WVVGLEGAEA PLPLMRGRAL ALAIGVAGVF LLLYSPLLAL VWRALERPGA       300
     WLSVWRNPDF TPGLLALQNT LAFAGVALLG VLPVGFLYAY AVWRGARWLD GLGLLPLMVS       360
     PVALGLGYLL VYPGLRGSIW LLIGAYILLS YPLLTRTLLP ALQGLPQGVL EAARVLGASP       420
     WRRFIGVEWP LVRPSTTAGL ALALAAILGE FGATLTLQRP EWATLSLAIY ERLGRPGATP       480
     FYEAVVLAVA LMALCTVLLL GLQKGTWER                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page