(data stored in ACNUC7421 zone)

EMBL: CP001743.PE452

CP001743.PE452       Location/Qualifiers
FT   CDS             complement(443834..444808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0457"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; SPTR: A7LSG1 Putative
FT                   uncharacterized protein; InterPro IPR013525; COGs: COG1277
FT                   ABC-type transport system involved in multi-copper enzyme
FT                   maturation permease component; KEGG: bpt:Bpet0290 putative
FT                   ABC-2 type transport system permease protein; PFAM: ABC-2
FT                   type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27234"
FT                   /protein_id="ADD27234.1"
FT                   /translation="MQHSSTSRRREGSPWTGLWAVFFKEMADHLSSTRMRILEVLILLS
FT                   AVGAVYAGAQTLRQTISEDPFLLLRVFTAAQDPLPSFVAFLSFFLPLAAIALGFDAING
FT                   EYSRNTLSRILAQPIYRDALLWGKFLAGLATIALILLALFLLVVGLSLIFLGVPPSSEE
FT                   VARALLFLLATLAYTGVWLGIALVTSVLFRSAATSALAAIAVWLFFALFWGIIAQLLAQ
FT                   AVAPFDPFNPESELRQTEALLAFSRLSPNTLYAEAIQALLNPGVRSLGPVLISQLEGAL
FT                   LGSPLPLGQSFLLAWPQLTGLIALTIGLFAVAYVLFQRREVRA"
     MQHSSTSRRR EGSPWTGLWA VFFKEMADHL SSTRMRILEV LILLSAVGAV YAGAQTLRQT        60
     ISEDPFLLLR VFTAAQDPLP SFVAFLSFFL PLAAIALGFD AINGEYSRNT LSRILAQPIY       120
     RDALLWGKFL AGLATIALIL LALFLLVVGL SLIFLGVPPS SEEVARALLF LLATLAYTGV       180
     WLGIALVTSV LFRSAATSAL AAIAVWLFFA LFWGIIAQLL AQAVAPFDPF NPESELRQTE       240
     ALLAFSRLSP NTLYAEAIQA LLNPGVRSLG PVLISQLEGA LLGSPLPLGQ SFLLAWPQLT       300
     GLIALTIGLF AVAYVLFQRR EVRA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page