(data stored in ACNUC7421 zone)

EMBL: CP001743.PE453

CP001743.PE453       Location/Qualifiers
FT   CDS             complement(444798..445727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0458"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: A8S3F5 Putative uncharacterized protein; KEGG:
FT                   mes:Meso_3123 ABC transporter related; COGs: COG1131
FT                   ABC-type multidrug transport system ATPase component;
FT                   InterPro IPR003439:IPR003593; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27235"
FT                   /protein_id="ADD27235.1"
FT                   /translation="MVIETQGLTKRYGRVVAVEGLELRIEAGEVYGLLGPNGSGKTTTI
FT                   LMLLGLTEPSAGQVRVLGLDPAREPLSLKRQVGYLPDSVGFYGEMSAWENLSYIARLNG
FT                   LPPALAKARMERVLERMGLTEVAHRPVGAFSRGMRQRLGLAEVLLKEPKVVILDEPTLG
FT                   LDPEAAQEFLQIIRSLKSEGITVLLSSHLLHQVQAICDRVGLFHKGKLVLEGRVEELAQ
FT                   RVLGGAYRIRLEATPLNGLAERLQALPEVSRVQAEGQGLRLEATQDIRPQVAKAVLEAG
FT                   AALQSLVLEQPSLDEVYARYFQEVRHAA"
     MVIETQGLTK RYGRVVAVEG LELRIEAGEV YGLLGPNGSG KTTTILMLLG LTEPSAGQVR        60
     VLGLDPAREP LSLKRQVGYL PDSVGFYGEM SAWENLSYIA RLNGLPPALA KARMERVLER       120
     MGLTEVAHRP VGAFSRGMRQ RLGLAEVLLK EPKVVILDEP TLGLDPEAAQ EFLQIIRSLK       180
     SEGITVLLSS HLLHQVQAIC DRVGLFHKGK LVLEGRVEEL AQRVLGGAYR IRLEATPLNG       240
     LAERLQALPE VSRVQAEGQG LRLEATQDIR PQVAKAVLEA GAALQSLVLE QPSLDEVYAR       300
     YFQEVRHAA                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page