(data stored in ACNUC7421 zone)

EMBL: CP001743.PE454

CP001743.PE454       Location/Qualifiers
FT   CDS             complement(445736..446875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A8S3F6 Putative uncharacterized protein; COGs:
FT                   COG1470 membrane protein; KEGG: mes:Meso_3122 hypothetical
FT                   protein; PFAM: NPCBM-associated, NEW3 domain of
FT                   alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27236"
FT                   /protein_id="ADD27236.1"
FT                   /translation="MPRLLALLLLMMSLGLAQGFRGLALYTPYPSQSVRLGETISLPIT
FT                   LKGYNLPPQTVQVRVAELAPGWKASLLGGGRVVGAVYVLPDGEQSLSLRLEPPQNVRAG
FT                   TYRFRLVAEGSGVRAELPIALTLGQVLPKRLSLETELPVLKGTPTASFRYRVTLRNESD
FT                   QDLLVNLEADAPENFRVSFSTAFGGQEINSLPLKAGESRDLEVQVTPPRQVEAKVYAVT
FT                   LRALAGEAKAELAVNLDITGQVELSLSTPEERLSGRAYAGRENPIKLVVKNNGSAPAEN
FT                   LELSASEPSGWEVRFEPDKIERLAPGAESEVTARIKPSSRAVAGDYMLTLRASAEGAQA
FT                   SADYRVTVQTSTLWGLIGVALIAVAVGAVGFAVSRFGRR"
     MPRLLALLLL MMSLGLAQGF RGLALYTPYP SQSVRLGETI SLPITLKGYN LPPQTVQVRV        60
     AELAPGWKAS LLGGGRVVGA VYVLPDGEQS LSLRLEPPQN VRAGTYRFRL VAEGSGVRAE       120
     LPIALTLGQV LPKRLSLETE LPVLKGTPTA SFRYRVTLRN ESDQDLLVNL EADAPENFRV       180
     SFSTAFGGQE INSLPLKAGE SRDLEVQVTP PRQVEAKVYA VTLRALAGEA KAELAVNLDI       240
     TGQVELSLST PEERLSGRAY AGRENPIKLV VKNNGSAPAE NLELSASEPS GWEVRFEPDK       300
     IERLAPGAES EVTARIKPSS RAVAGDYMLT LRASAEGAQA SADYRVTVQT STLWGLIGVA       360
     LIAVAVGAVG FAVSRFGRR                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page