(data stored in ACNUC7421 zone)

EMBL: CP001743.PE455

CP001743.PE455       Location/Qualifiers
FT   CDS             447034..447501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0460"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; CS; SPTR: P46729 18
FT                   kDa antigen 1; InterPro IPR017447:IPR002068; COGs: COG0071
FT                   Molecular chaperone (small heat shock protein); KEGG:
FT                   wpi:WPa_0614 heat shock protein, HSP20 family; PFAM: CS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27237"
FT                   /protein_id="ADD27237.1"
FT                   /translation="MLDIVRNVPVQTMPLRSWNLSSVNDFFHEFDRLWNEVTTSLGSAW
FT                   PAGVYPYDLYETGDSLVLEMAVPGLRKDDLEVRLEGNRLTIRGTYPEAQGSDERRYWSR
FT                   GLPRGSFVQSLTLPASVEVDKIQATITDGLLRLTLPKVEQARVRKIAISAA"
     MLDIVRNVPV QTMPLRSWNL SSVNDFFHEF DRLWNEVTTS LGSAWPAGVY PYDLYETGDS        60
     LVLEMAVPGL RKDDLEVRLE GNRLTIRGTY PEAQGSDERR YWSRGLPRGS FVQSLTLPAS       120
     VEVDKIQATI TDGLLRLTLP KVEQARVRKI AISAA                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page