(data stored in ACNUC7421 zone)

EMBL: CP001743.PE459

CP001743.PE459       Location/Qualifiers
FT   CDS             449921..450568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0464"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; SPTR: A3ICN9 YsiA;
FT                   InterPro IPR001647; COGs: COG1309 Transcriptional
FT                   regulator; KEGG: ppr:PBPRA0090 TetR family transcriptional
FT                   regulator; PFAM: Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27241"
FT                   /protein_id="ADD27241.1"
FT                   /translation="MNRFKNTNGCLEKPVSSLAFGVLVDFVAVTVEARTAPKREAILEA
FT                   TIRVLRDRGLSGLKVEEVAREAEVGKGTVYLYFQDKQDLLKALVEHHTFTYYRKVEEVV
FT                   SRGGPFRERLAEVLRLRVDWVEEWRGLWAAVAREAQPEDTTGWLRGMHEHYQRLLERLV
FT                   QEGKARGEVRSELDTCLTAASIAALACNPQLEFPREAYLEHLLEVLLKGVAL"
     MNRFKNTNGC LEKPVSSLAF GVLVDFVAVT VEARTAPKRE AILEATIRVL RDRGLSGLKV        60
     EEVAREAEVG KGTVYLYFQD KQDLLKALVE HHTFTYYRKV EEVVSRGGPF RERLAEVLRL       120
     RVDWVEEWRG LWAAVAREAQ PEDTTGWLRG MHEHYQRLLE RLVQEGKARG EVRSELDTCL       180
     TAASIAALAC NPQLEFPREA YLEHLLEVLL KGVAL                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page