(data stored in ACNUC7421 zone)

EMBL: CP001743.PE46

CP001743.PE46        Location/Qualifiers
FT   CDS             40126..41331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0047"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   A6E7B4 Tetracycline resistance protein; InterPro
FT                   IPR001958:IPR011701:IPR007114:IPR005829; COGs: COG2814
FT                   Arabinose efflux permease; KEGG: rce:RC1_1688 tetracycline
FT                   resistance protein, class C; PFAM: Major Facilitator
FT                   Superfamily; TIGRFAM: Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26828"
FT                   /protein_id="ADD26828.1"
FT                   /translation="MSKSASIPFILISVLINVMGLGLVIPVLPKLIETLAGGVEAGARL
FT                   NGLFFAVYAVMQFAFGPILGMLSDRYGRRPVLLASLVGTAVDYLIAALTQSIWVLFAAR
FT                   VIAGALGASLSTANAYIADISKPEERARNFGLIGATFGMGFVLGPVLGGLLGNIDLRLP
FT                   FYFAAGLAFLNFLYGYFVLPESLKPENRNTQARSLNPFVALGILRKTPILRGLSLSLAL
FT                   IFLAFGSLQSVWVLYTAYKFGWEPLEVGFSLFLVGLGGVIVQAGLVRPVVAHLGERRAL
FT                   TLAQSMGLFSFTLYGLATQGWMMYAIIALAALSNLGQPLIQSFLTREVSPQEQGTLQGA
FT                   LAGLQSLTVAVGGLLGGFLFSVVARPEVAPWLVGLPFFVGALLYATAAANTARLFRGLR
FT                   GS"
     MSKSASIPFI LISVLINVMG LGLVIPVLPK LIETLAGGVE AGARLNGLFF AVYAVMQFAF        60
     GPILGMLSDR YGRRPVLLAS LVGTAVDYLI AALTQSIWVL FAARVIAGAL GASLSTANAY       120
     IADISKPEER ARNFGLIGAT FGMGFVLGPV LGGLLGNIDL RLPFYFAAGL AFLNFLYGYF       180
     VLPESLKPEN RNTQARSLNP FVALGILRKT PILRGLSLSL ALIFLAFGSL QSVWVLYTAY       240
     KFGWEPLEVG FSLFLVGLGG VIVQAGLVRP VVAHLGERRA LTLAQSMGLF SFTLYGLATQ       300
     GWMMYAIIAL AALSNLGQPL IQSFLTREVS PQEQGTLQGA LAGLQSLTVA VGGLLGGFLF       360
     SVVARPEVAP WLVGLPFFVG ALLYATAAAN TARLFRGLRG S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page