(data stored in ACNUC7421 zone)

EMBL: CP001743.PE463

CP001743.PE463       Location/Qualifiers
FT   CDS             complement(453008..455590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0468"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; protease-associated PA domain protein; SPTR:
FT                   Q6H8Q3 Subtilisin-like protease (Fragment); InterPro
FT                   IPR000209:IPR003137; COGs: COG1404 Subtilisin-like serine
FT                   protease; KEGG: scl:sce3689 subtilisin like protease; PFAM:
FT                   Subtilase family; Domain of Unknown Function (DUF1034)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27245"
FT                   /protein_id="ADD27245.1"
FT                   /translation="MRKLLLLVGMSALLAACGGPRSSKPSLEVIASLPPAPASPMVDET
FT                   PTRWFVELSGGAVSDGISLQSIQAQHAAFRQAAQAAGVKILFAYTQLFNGFSVEVPGNN
FT                   RKLLYTLPGVEGVYPIGTYKLPPREAANPDLASAITQTGADIAQNDLGLTGRGVKVGII
FT                   DSGIDLEHPAFAGRIVDGYDFVGDAYDASDPAKSTPVPDPNPDDCDGHGTHVAGIVGGK
FT                   DSQITGVAPGVQFGAYKVFGCEGSTGDDVILAALERAETAGMDVVNMSLGSPFGWSVLG
FT                   KSITKMVKRGTVVVASAGNNGNLGLFATGDPAATEGVLSVASFDNIAVNAQKAVVNATG
FT                   APLGYLVLGGAEAPPTSGTSAEVVWVGRGCNADALLADPNGKVALMERGACTFNEKYQK
FT                   AVAAGAVGVIIHNNAPGLFAGGGVAGVAGKFGISISQADGLALRGLTSPTTLTWTPDTT
FT                   QVSNPTGNLISSFSSWGLSQDLKLKPDLGAPGGLIRSAVPLEQGSYAILSGTSMSAPHV
FT                   AGAVALLLEGNPAFWGPQKPSEVRKYLQNTAMPKLFALAPSSGLPETSYREGAGMIDIV
FT                   AAVQNRVTVTPSAISFAEKAGTHTERLVLKNRSNVPLIYRPVHLPGPSAFGSIYSPSFA
FT                   IAPATVSFSHTQVTVPARGEAVLTVTITPPAGLPNKGLFGGYILLQPVGAGLMMNVPYV
FT                   GMQGGYQAVQILTPASAGFPLLGKLNAAGTGYDLLPSGGTFTLQGNDLPVVLAHFEHGA
FT                   QVYEMVILNAATNAPIHPKYSRADYGEYIPRNSSANGFFAIPWDGTRITRYAKEDVYGN
FT                   KIPVPSEFQAVPDGQYKLQLRVLKPTGRMSNPADWESWISPVITIDRP"
     MRKLLLLVGM SALLAACGGP RSSKPSLEVI ASLPPAPASP MVDETPTRWF VELSGGAVSD        60
     GISLQSIQAQ HAAFRQAAQA AGVKILFAYT QLFNGFSVEV PGNNRKLLYT LPGVEGVYPI       120
     GTYKLPPREA ANPDLASAIT QTGADIAQND LGLTGRGVKV GIIDSGIDLE HPAFAGRIVD       180
     GYDFVGDAYD ASDPAKSTPV PDPNPDDCDG HGTHVAGIVG GKDSQITGVA PGVQFGAYKV       240
     FGCEGSTGDD VILAALERAE TAGMDVVNMS LGSPFGWSVL GKSITKMVKR GTVVVASAGN       300
     NGNLGLFATG DPAATEGVLS VASFDNIAVN AQKAVVNATG APLGYLVLGG AEAPPTSGTS       360
     AEVVWVGRGC NADALLADPN GKVALMERGA CTFNEKYQKA VAAGAVGVII HNNAPGLFAG       420
     GGVAGVAGKF GISISQADGL ALRGLTSPTT LTWTPDTTQV SNPTGNLISS FSSWGLSQDL       480
     KLKPDLGAPG GLIRSAVPLE QGSYAILSGT SMSAPHVAGA VALLLEGNPA FWGPQKPSEV       540
     RKYLQNTAMP KLFALAPSSG LPETSYREGA GMIDIVAAVQ NRVTVTPSAI SFAEKAGTHT       600
     ERLVLKNRSN VPLIYRPVHL PGPSAFGSIY SPSFAIAPAT VSFSHTQVTV PARGEAVLTV       660
     TITPPAGLPN KGLFGGYILL QPVGAGLMMN VPYVGMQGGY QAVQILTPAS AGFPLLGKLN       720
     AAGTGYDLLP SGGTFTLQGN DLPVVLAHFE HGAQVYEMVI LNAATNAPIH PKYSRADYGE       780
     YIPRNSSANG FFAIPWDGTR ITRYAKEDVY GNKIPVPSEF QAVPDGQYKL QLRVLKPTGR       840
     MSNPADWESW ISPVITIDRP                                                   860
//

If you have problems or comments...

PBIL Back to PBIL home page