(data stored in ACNUC7421 zone)

EMBL: CP001743.PE464

CP001743.PE464       Location/Qualifiers
FT   CDS             455853..457286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0469"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM:
FT                   Anticodon-binding domain protein; Prolyl-tRNA synthetase,
FT                   class II-like; tRNA synthetase class II (G H P and S);
FT                   InterProIPR002316:IPR002314:IPR016061:IPR004154:IPR
FT                   006195:IPR004499; KEGG: mxa:MXAN_6655 prolyl-tRNA
FT                   synthetase; COGs: COG0442 Prolyl-tRNA synthetase; SPTR:
FT                   Q72GF9 Prolyl-tRNA synthetase; PFAM: Anticodon binding
FT                   domain; tRNA synthetase class II core domain (G, H, P, S
FT                   and T); Prolyl-tRNA synthetase, C-terminal; TIGRFAM:
FT                   prolyl-tRNA synthetase, family I"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27246"
FT                   /protein_id="ADD27246.1"
FT                   /translation="MAKDKGLTPQSQDFNEWYNEVVLKADLVDYGPVRGTMVVKPYGYA
FT                   IWENIQRELDRMFKETGHQNAYFPLFIPISFLQKEAEHVEGFAPELAVVTQAGGETLEE
FT                   PLAVRPTSETIIGHMWAKWIRTYRDLPQLLNQWNSVVRWELRTKLFLRTTEFLWQEGHT
FT                   AHATQEEAEEEARRMAGVYATVLRDWCAIPGWEGPKTESEKFAGAVYSISYEAMMRDGK
FT                   ALQSCTSHYLGQNFARAFDIQFQDKDQQNKYVHTTSWGFTTRVVGALVMTHGDDKGLIL
FT                   PPRLAPIQVVIVPIYKAETREAVLPAAERLYQELKAAGIRVHLDDRDQYSPGYKFNEWE
FT                   LKGVPLRLELGPRDVEAGTAVLASRLGGKETLQISELLGLLPARLEQFQRDLYQRALEF
FT                   RDAHTWAVDSYEAFKEKVEQGFVKAFHCGDKECEKQIKAETTATTRCIPYDEPEAQGSC
FT                   VRCGKPSAYGKRILFAKAY"
     MAKDKGLTPQ SQDFNEWYNE VVLKADLVDY GPVRGTMVVK PYGYAIWENI QRELDRMFKE        60
     TGHQNAYFPL FIPISFLQKE AEHVEGFAPE LAVVTQAGGE TLEEPLAVRP TSETIIGHMW       120
     AKWIRTYRDL PQLLNQWNSV VRWELRTKLF LRTTEFLWQE GHTAHATQEE AEEEARRMAG       180
     VYATVLRDWC AIPGWEGPKT ESEKFAGAVY SISYEAMMRD GKALQSCTSH YLGQNFARAF       240
     DIQFQDKDQQ NKYVHTTSWG FTTRVVGALV MTHGDDKGLI LPPRLAPIQV VIVPIYKAET       300
     REAVLPAAER LYQELKAAGI RVHLDDRDQY SPGYKFNEWE LKGVPLRLEL GPRDVEAGTA       360
     VLASRLGGKE TLQISELLGL LPARLEQFQR DLYQRALEFR DAHTWAVDSY EAFKEKVEQG       420
     FVKAFHCGDK ECEKQIKAET TATTRCIPYD EPEAQGSCVR CGKPSAYGKR ILFAKAY          477
//

If you have problems or comments...

PBIL Back to PBIL home page