(data stored in ACNUC7421 zone)

EMBL: CP001743.PE466

CP001743.PE466       Location/Qualifiers
FT   CDS             complement(458004..458237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27248"
FT                   /protein_id="ADD27248.1"
FT                   /translation="MRQFQFRLPQGPLGVLILLLAGTVGLFLVLWLITTLWVLAVGAGL
FT                   VGALAYGWRRLEARFRPRRWRRLPQKVRRWED"
     MRQFQFRLPQ GPLGVLILLL AGTVGLFLVL WLITTLWVLA VGAGLVGALA YGWRRLEARF        60
     RPRRWRRLPQ KVRRWED                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page