(data stored in ACNUC7421 zone)

EMBL: CP001743.PE468

CP001743.PE468       Location/Qualifiers
FT   CDS             459392..459796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0473"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   SPTR: A4BBW7 Putative uncharacterized protein; InterPro
FT                   IPR012312:IPR012827; COGs: COG2703 Hemerythrin; KEGG:
FT                   ank:AnaeK_3116 hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain; TIGRFAM:
FT                   hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27250"
FT                   /protein_id="ADD27250.1"
FT                   /translation="MPIQWSQQYEVGDPRTDRQHQNLFEYVNRIEQLIEQGRAGRLNSQ
FT                   EVEHLFIFLDAYVNTHFAYEELCMTLRGCKMAQKNKEAHDRFLKFWAEFSRAHTPQNIT
FT                   VAALETLRTTLAGWLTQHICKIDVALRQTT"
     MPIQWSQQYE VGDPRTDRQH QNLFEYVNRI EQLIEQGRAG RLNSQEVEHL FIFLDAYVNT        60
     HFAYEELCMT LRGCKMAQKN KEAHDRFLKF WAEFSRAHTP QNITVAALET LRTTLAGWLT       120
     QHICKIDVAL RQTT                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page