(data stored in ACNUC7421 zone)

EMBL: CP001743.PE47

CP001743.PE47        Location/Qualifiers
FT   CDS             complement(41328..41819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0048"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; InterPro IPR002589;
FT                   KEGG: sfu:Sfum_0998 Appr-1-p processing domain protein;
FT                   COGs: COG2110 phosphatase homologous to the C-terminal
FT                   domain of histone macroH2A1; SPTR: A8A9L9 Appr-1-p
FT                   processing domain protein; PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26829"
FT                   /protein_id="ADD26829.1"
FT                   /translation="MARIQVAQGDITEFAGDAIVNAANNHLILGSGVAGAIRRRGGPSI
FT                   QGECDRHGPIRVGEAALTGAGQLPVRKVIHAAVLGDQPATLDTVRSATQAALRLALEHR
FT                   LYRLAFPLLGTGVGGLGVPQVAEVMLDELEAAPDPLEITLYGYSQADAEAIRQALARRR
FT                   "
     MARIQVAQGD ITEFAGDAIV NAANNHLILG SGVAGAIRRR GGPSIQGECD RHGPIRVGEA        60
     ALTGAGQLPV RKVIHAAVLG DQPATLDTVR SATQAALRLA LEHRLYRLAF PLLGTGVGGL       120
     GVPQVAEVML DELEAAPDPL EITLYGYSQA DAEAIRQALA RRR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page