(data stored in ACNUC7421 zone)

EMBL: CP001743.PE471

CP001743.PE471       Location/Qualifiers
FT   CDS             461643..464366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0476"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; SPTR: A3LJB1 Pyruvate dehydrogenase;
FT                   InterPro IPR004660; COGs: COG2609 Pyruvate dehydrogenase
FT                   complex dehydrogenase (E1) component; KEGG:
FT                   aba:Acid345_2792 pyruvate dehydrogenase subunit E1;
FT                   TIGRFAM: pyruvate dehydrogenase E1 component, homodimeric
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27253"
FT                   /protein_id="ADD27253.1"
FT                   /translation="MVEDRELIAARAELSAEEQVKLEDLENQEWRESLEYVLRTAGRDR
FT                   VAQLMEMLENYAYRNGVVIHDKVNTPYVNTISLEHQPPYPGDLELEQRIANILRWNTIA
FT                   IVQQANKKSDGIGGHIATYASIAELMEMGFNHFFRGHDAPDRDLVFYQGHMSPGVYARS
FT                   YLEGRLTEDDLGKFRRELLGGPGRGLSSYPHPWLMPDYWEFPTVSMGLGPIQAIYQARF
FT                   MRYLEDRGLKPKTNAKVWAFLGDGEQDEVETLGALRVAASEELDNLIFVINANLQRLDG
FT                   PVRGNSKVIQELESVYRGNGWNVIKVVWGSAWDELFAKDTEGVLLERMEQLVDGESQRY
FT                   AAYGGKELREKFFNTPALKKLIEGLSDEDLDRLTLSRGGHDNRKIYAAYKAAVEHRGSP
FT                   TVIIARTVKGYCLGPTAQAKNVAHQVKKLTLEDLREARDHLGIPIPDEDLEKTPFYHPG
FT                   KDSPEVRYMLERRKALGGLIPERRVREYRLKTPDLAFFEEFLAGSGGREISTTMAFVRM
FT                   LTKLVRHPEVGKYIVPIVPDEARTFGMEGVISSVGIYSPKGQLYTPVDAGTVTVYRESE
FT                   TGQLLQEGINEAGAMSSFIAAGTAYAHHGIPTIPFYIYYSMFGLQRVGDLVWAAADQRT
FT                   KGFLLGATAGRTTLNGEGLQHEDGHSHVLALPVPNMPAYDPAFAYELAVILQDGMKRMY
FT                   QDGEDIFYYITLMNENYVQPAMPEPREETRQGILKGLYLFKKSELKKPKARVQLLGSGT
FT                   ILNEVIKAAEMLERDYGIAADIWSATSYKTLYYEALETARTNRLNPSSKPRLSYVAQCL
FT                   NPTEGPIVAASDYMKALPDLLSGYLNRPIHSLGTDGFGRSETREALRDFFEVDAKHVVI
FT                   TALSALRGEGKVSASTFTEAIKKLGIDPKREHPHKR"
     MVEDRELIAA RAELSAEEQV KLEDLENQEW RESLEYVLRT AGRDRVAQLM EMLENYAYRN        60
     GVVIHDKVNT PYVNTISLEH QPPYPGDLEL EQRIANILRW NTIAIVQQAN KKSDGIGGHI       120
     ATYASIAELM EMGFNHFFRG HDAPDRDLVF YQGHMSPGVY ARSYLEGRLT EDDLGKFRRE       180
     LLGGPGRGLS SYPHPWLMPD YWEFPTVSMG LGPIQAIYQA RFMRYLEDRG LKPKTNAKVW       240
     AFLGDGEQDE VETLGALRVA ASEELDNLIF VINANLQRLD GPVRGNSKVI QELESVYRGN       300
     GWNVIKVVWG SAWDELFAKD TEGVLLERME QLVDGESQRY AAYGGKELRE KFFNTPALKK       360
     LIEGLSDEDL DRLTLSRGGH DNRKIYAAYK AAVEHRGSPT VIIARTVKGY CLGPTAQAKN       420
     VAHQVKKLTL EDLREARDHL GIPIPDEDLE KTPFYHPGKD SPEVRYMLER RKALGGLIPE       480
     RRVREYRLKT PDLAFFEEFL AGSGGREIST TMAFVRMLTK LVRHPEVGKY IVPIVPDEAR       540
     TFGMEGVISS VGIYSPKGQL YTPVDAGTVT VYRESETGQL LQEGINEAGA MSSFIAAGTA       600
     YAHHGIPTIP FYIYYSMFGL QRVGDLVWAA ADQRTKGFLL GATAGRTTLN GEGLQHEDGH       660
     SHVLALPVPN MPAYDPAFAY ELAVILQDGM KRMYQDGEDI FYYITLMNEN YVQPAMPEPR       720
     EETRQGILKG LYLFKKSELK KPKARVQLLG SGTILNEVIK AAEMLERDYG IAADIWSATS       780
     YKTLYYEALE TARTNRLNPS SKPRLSYVAQ CLNPTEGPIV AASDYMKALP DLLSGYLNRP       840
     IHSLGTDGFG RSETREALRD FFEVDAKHVV ITALSALRGE GKVSASTFTE AIKKLGIDPK       900
     REHPHKR                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page