(data stored in ACNUC7421 zone)

EMBL: CP001743.PE472

CP001743.PE472       Location/Qualifiers
FT   CDS             464402..465697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0477"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; SPTR:
FT                   A4LDI0 Pyruvate dehydrogenase complex E2 component,
FT                   dihydrolipoamide acetyltransferase; InterPro
FT                   IPR004167:IPR000089:IPR001078; COGs: COG0508
FT                   Pyruvate/2-oxoglutarate dehydrogenase complex
FT                   dihydrolipoamide acyltransferase (E2) protein; KEGG:
FT                   noc:Noc_1255 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2; PFAM: e3 binding domain; 2-oxoacid
FT                   dehydrogenases acyltransferase (catalytic domain);
FT                   Biotin-requiring enzyme; TIGRFAM: pyruvate dehydrogenase
FT                   complex dihydrolipoamide acetyltransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27254"
FT                   /protein_id="ADD27254.1"
FT                   /translation="MAELKLPDLGDNVTSAVVVGVLIKEGDTIAAGQPVLELETDKAVM
FT                   EAPASEGGTVSKVLVKPGDEVKSGQVIAVLGDAAPSAEKQEPKEKQEPKEEKAAPAPAP
FT                   TPAPAATPSAPAAAPRPPASAAPAGQRRLIPAAPSVRRLAREMGINLMEVVGSGPAYRI
FT                   SENDLKRFAAGEAPTTAAPQPSSAPALPDFSKFGPVRREAMSGVRRATVRSMAQAWSTI
FT                   PMVTHFDRADITEMEALRKRMAPRAEQRGAKVTMTAILLKIAAAALKQFPKFNASIDTA
FT                   SNEIIYKDYIHIGVAVDTPTGLLVPVVRDVDKKGVIALAKELGEIAAKARERKLTPEEM
FT                   QGATFTISNLGGIGGTGFTPIVNWPEVAIMGVSRSSMEPVWSAEKGVFEPRNIMPFSLS
FT                   YDHRLIDGADAARFCRFVAELLEDPFLLGFEG"
     MAELKLPDLG DNVTSAVVVG VLIKEGDTIA AGQPVLELET DKAVMEAPAS EGGTVSKVLV        60
     KPGDEVKSGQ VIAVLGDAAP SAEKQEPKEK QEPKEEKAAP APAPTPAPAA TPSAPAAAPR       120
     PPASAAPAGQ RRLIPAAPSV RRLAREMGIN LMEVVGSGPA YRISENDLKR FAAGEAPTTA       180
     APQPSSAPAL PDFSKFGPVR REAMSGVRRA TVRSMAQAWS TIPMVTHFDR ADITEMEALR       240
     KRMAPRAEQR GAKVTMTAIL LKIAAAALKQ FPKFNASIDT ASNEIIYKDY IHIGVAVDTP       300
     TGLLVPVVRD VDKKGVIALA KELGEIAAKA RERKLTPEEM QGATFTISNL GGIGGTGFTP       360
     IVNWPEVAIM GVSRSSMEPV WSAEKGVFEP RNIMPFSLSY DHRLIDGADA ARFCRFVAEL       420
     LEDPFLLGFE G                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page