(data stored in ACNUC7421 zone)

EMBL: CP001743.PE475

CP001743.PE475       Location/Qualifiers
FT   CDS             467834..468811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0480"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; SPTR: A6DBB0
FT                   Exopolyphosphatase-related protein; InterPro
FT                   IPR003156:IPR001667; COGs: COG0618
FT                   Exopolyphosphatase-related protein; KEGG: phosphoesterase
FT                   RecJ domain protein; K06881; PFAM: DHHA1 domain; DHH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27257"
FT                   /protein_id="ADD27257.1"
FT                   /translation="MDDAHNAPEPRYWEKIRTVADTLRELEGPIIVVSHVDPDGDAIGS
FT                   SLGLFRALQALDKKVTWIADPPRFLRFLVREDEYSDPIQHVPEGATLVVLDSAEPSRVA
FT                   GAPVEGFVINIDHHGTNPRFGYLSVVDPSKAATAQIVKDLIDALGVTWTPEIATPVLTG
FT                   LITDTGNFRFANTTPEVLHTAAELVGYGVRLAELTDRLQWRPVSYFKVMGAVLSTVGFH
FT                   FGGLLVTAHMPSGINVEDSDDFVGIIRYAEGSQIAVFLREREEGVKISIRSRGGVSAQA
FT                   VAVKLGGGGHVPAAGATLRGLTLEEAYPRVLAAVEEELRRAGYL"
     MDDAHNAPEP RYWEKIRTVA DTLRELEGPI IVVSHVDPDG DAIGSSLGLF RALQALDKKV        60
     TWIADPPRFL RFLVREDEYS DPIQHVPEGA TLVVLDSAEP SRVAGAPVEG FVINIDHHGT       120
     NPRFGYLSVV DPSKAATAQI VKDLIDALGV TWTPEIATPV LTGLITDTGN FRFANTTPEV       180
     LHTAAELVGY GVRLAELTDR LQWRPVSYFK VMGAVLSTVG FHFGGLLVTA HMPSGINVED       240
     SDDFVGIIRY AEGSQIAVFL REREEGVKIS IRSRGGVSAQ AVAVKLGGGG HVPAAGATLR       300
     GLTLEEAYPR VLAAVEEELR RAGYL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page