(data stored in ACNUC7421 zone)

EMBL: CP001743.PE476

CP001743.PE476       Location/Qualifiers
FT   CDS             469172..470440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0481"
FT                   /product="O-acetylhomoserineaminocarboxypropyltransferase"
FT                   /EC_number="2.5.1.49"
FT                   /note="PRIAM: O-acetylhomoserine
FT                   aminocarboxypropyltransferase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aminotransferase class-III; InterPro
FT                   IPR005814:IPR000653:IPR000277:IPR002155; KEGG: hypothetical
FT                   protein; K01740 O-acetylhomoserine (thiol)-lyase; COGs:
FT                   COG2873 O-acetylhomoserine sulfhydrylase; SPTR: A4CV58
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27258"
FT                   /protein_id="ADD27258.1"
FT                   /translation="MDFSSLAVLSGLPQQDPHNAVGVPIYATAAYGFADLEDGAHKFAT
FT                   NQGYTYTRLQNPTVAALEARLTALEGALGAVCLASGQAASFAGLLALVRAGDEVVASPG
FT                   LFGGTVGLLNQVFGLMGVRVHFVAPEVAAVQAALNEKTRAVFVEVLGNPSLELPDLQGL
FT                   AELCEAHRVALVVDNTFGAVGALARPLEHGAHVVVHSLTKWASGHGSILGGAVLSRETA
FT                   LWQHYPQFTSPDAQGKIPWEQFGARCFLERVRQLGLSLGGMVLSPFNAYLLFQGLETVA
FT                   LRIERASQTALTLARWLESQPQVAWVRYPGLPTDPAHPRATQYLRGGFGSILTFGIRGG
FT                   LEGASRFLANLKIIQAPNVGDARTLAVHPWTTTHSRIPEAARRAAGVGPETIRLSVGLE
FT                   SPQDIQQMLLEALASVEQVGHEG"
     MDFSSLAVLS GLPQQDPHNA VGVPIYATAA YGFADLEDGA HKFATNQGYT YTRLQNPTVA        60
     ALEARLTALE GALGAVCLAS GQAASFAGLL ALVRAGDEVV ASPGLFGGTV GLLNQVFGLM       120
     GVRVHFVAPE VAAVQAALNE KTRAVFVEVL GNPSLELPDL QGLAELCEAH RVALVVDNTF       180
     GAVGALARPL EHGAHVVVHS LTKWASGHGS ILGGAVLSRE TALWQHYPQF TSPDAQGKIP       240
     WEQFGARCFL ERVRQLGLSL GGMVLSPFNA YLLFQGLETV ALRIERASQT ALTLARWLES       300
     QPQVAWVRYP GLPTDPAHPR ATQYLRGGFG SILTFGIRGG LEGASRFLAN LKIIQAPNVG       360
     DARTLAVHPW TTTHSRIPEA ARRAAGVGPE TIRLSVGLES PQDIQQMLLE ALASVEQVGH       420
     EG                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page