(data stored in ACNUC7421 zone)

EMBL: CP001743.PE478

CP001743.PE478       Location/Qualifiers
FT   CDS             471414..472565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0483"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; SPTR:
FT                   O28179 Alcohol dehydrogenase, zinc-dependent; InterPro
FT                   IPR013154:IPR013149; COGs: COG1063 Threonine dehydrogenase
FT                   and related Zn-dependent dehydrogenase; KEGG: sfu:Sfum_2251
FT                   alcohol dehydrogenase GroES domain protein; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27260"
FT                   /protein_id="ADD27260.1"
FT                   /translation="MRGLLFTPSVPRYVAARLLGKRYPSRALSLQLVTLPEPERPAGFE
FT                   RLKVRLSGICGSDLALLYGKQAPTLSGMFSFPAILGHEILAELGGVRVVVNPVLACLER
FT                   GLPDCPACARGDDHLCFNVAEGNFGPGMLGFCKDLGGGWAQRMVAHRERIFPIAESVPD
FT                   ERAVLAEPAAVVLHGLRQAWGEGKPWPNPAVHRMHWPAQILVIGAGTIGLLAVKMLRVL
FT                   GFEGPLWAVARHPRQAELARQLGASQVFPSAQAAQQAAGARRYRGILGSTAWRGGFEGV
FT                   VEASGSPRGLQEASWAVQEGGRVLLLGAPATALHDFSPYWFREVGLVGSYAYSWDDFAQ
FT                   AVKLLPELEGVEAMVTHKFGLEAWPEAIKTAATRRGIKVVFKP"
     MRGLLFTPSV PRYVAARLLG KRYPSRALSL QLVTLPEPER PAGFERLKVR LSGICGSDLA        60
     LLYGKQAPTL SGMFSFPAIL GHEILAELGG VRVVVNPVLA CLERGLPDCP ACARGDDHLC       120
     FNVAEGNFGP GMLGFCKDLG GGWAQRMVAH RERIFPIAES VPDERAVLAE PAAVVLHGLR       180
     QAWGEGKPWP NPAVHRMHWP AQILVIGAGT IGLLAVKMLR VLGFEGPLWA VARHPRQAEL       240
     ARQLGASQVF PSAQAAQQAA GARRYRGILG STAWRGGFEG VVEASGSPRG LQEASWAVQE       300
     GGRVLLLGAP ATALHDFSPY WFREVGLVGS YAYSWDDFAQ AVKLLPELEG VEAMVTHKFG       360
     LEAWPEAIKT AATRRGIKVV FKP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page