(data stored in ACNUC7421 zone)

EMBL: CP001743.PE479

CP001743.PE479       Location/Qualifiers
FT   CDS             472719..473117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27261"
FT                   /protein_id="ADD27261.1"
FT                   /translation="MTGDKSVRDWAAIALGAVVLLGFAALVVYMLGLLTADETTWGRAL
FT                   YLFAGVEAIAFAAAGYLFGREVHRARAEQAEARAHHAEEQWQRWSRRALEAEAKGQSLS
FT                   TTIALWAQQHPELAPAAQMAQRLFPDRP"
     MTGDKSVRDW AAIALGAVVL LGFAALVVYM LGLLTADETT WGRALYLFAG VEAIAFAAAG        60
     YLFGREVHRA RAEQAEARAH HAEEQWQRWS RRALEAEAKG QSLSTTIALW AQQHPELAPA       120
     AQMAQRLFPD RP                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page