(data stored in ACNUC7421 zone)

EMBL: CP001743.PE484

CP001743.PE484       Location/Qualifiers
FT   CDS             complement(477005..477349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27266"
FT                   /protein_id="ADD27266.1"
FT                   /translation="MKQAAILIMTSERNPSGLRTTTGTGWSKLYLAADYYLDLSYKQNG
FT                   QQAFLVGQVLHEDGVSFSTGTATLLNPQGVPLQTTELTPKAGFRLAVGDLTAHRLELTL
FT                   DQTTFDIALS"
     MKQAAILIMT SERNPSGLRT TTGTGWSKLY LAADYYLDLS YKQNGQQAFL VGQVLHEDGV        60
     SFSTGTATLL NPQGVPLQTT ELTPKAGFRL AVGDLTAHRL ELTLDQTTFD IALS             114
//

If you have problems or comments...

PBIL Back to PBIL home page