(data stored in ACNUC7421 zone)

EMBL: CP001743.PE485

CP001743.PE485       Location/Qualifiers
FT   CDS             477485..478153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0490"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; InterPro
FT                   IPR007630; KEGG: nar:Saro_3770 regulatory protein, LuxR;
FT                   PFAM: Sigma-70, region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27267"
FT                   /protein_id="ADD27267.1"
FT                   /translation="MPKKTPGQYFLSKGISPSQLADRLEQLYPLEREVLLARASGETLR
FT                   AIGGRLDLTPEGVRQVEIRALKKLREEDDTAQIQGRRFRLAVEQRLGVPLEKAVEGLPE
FT                   PQPMLVLAYARGEPLADLAPTLGLSITEATALRDQAVACLLGEDRGSRAGKWAELKAAV
FT                   AAALIESPLTYDDLEARFPMSRRRLMKLMQELVNEGRAELSDEYPFRFLGVKPPQRALD
FT                   "
     MPKKTPGQYF LSKGISPSQL ADRLEQLYPL EREVLLARAS GETLRAIGGR LDLTPEGVRQ        60
     VEIRALKKLR EEDDTAQIQG RRFRLAVEQR LGVPLEKAVE GLPEPQPMLV LAYARGEPLA       120
     DLAPTLGLSI TEATALRDQA VACLLGEDRG SRAGKWAELK AAVAAALIES PLTYDDLEAR       180
     FPMSRRRLMK LMQELVNEGR AELSDEYPFR FLGVKPPQRA LD                          222
//

If you have problems or comments...

PBIL Back to PBIL home page