(data stored in ACNUC7421 zone)

EMBL: CP001743.PE486

CP001743.PE486       Location/Qualifiers
FT   CDS             478591..479946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0491"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; SPTR: Q8TGY9
FT                   2-phosphoglycerate kinase; InterPro IPR005144; COGs:
FT                   COG2074 2-phosphoglycerate kinase; KEGG: hypothetical
FT                   protein; PFAM: ATP cone domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27268"
FT                   /protein_id="ADD27268.1"
FT                   /translation="MMAGLKMEPAMSVAHTIEEQLRSRKKPEVTALALKKMLIQEVEKN
FT                   FGPEMAERLRGQTQAFEDIVVREGYRRRPFSKGVLVRSLEDAGFSMREAQTIARSLENR
FT                   LRRSGVRSIDADELERRIAAEIEELFGPAARNRYAGRQALAGEIFVEEGEGEPRVPFSK
FT                   GVLAQSVMAVGLSPDAAYRLARDVERRLRDSGSTVVKRDYLRKAVSEELMEEAGEEVAR
FT                   RYHLLRSIRRAVKPVHLLIGGVAGVGKSVLASALAYRLGITRMISTDAVREILRATIPK
FT                   DLLPTLHTSSFESWRVLATPQKAEPSAALVMQGFRDQVSRVAVGLRAIQERSAREKTSL
FT                   VVEGVHVVPGYMTHQYQHEVIQIPIMLVLEDEALHRDRFALRERETGGSRTSGAYAQYF
FT                   SEIRLIQQHLIELARGAGVPLIPAENLDRAIDKGLEVIVDRLQEAYFDVVQG"
     MMAGLKMEPA MSVAHTIEEQ LRSRKKPEVT ALALKKMLIQ EVEKNFGPEM AERLRGQTQA        60
     FEDIVVREGY RRRPFSKGVL VRSLEDAGFS MREAQTIARS LENRLRRSGV RSIDADELER       120
     RIAAEIEELF GPAARNRYAG RQALAGEIFV EEGEGEPRVP FSKGVLAQSV MAVGLSPDAA       180
     YRLARDVERR LRDSGSTVVK RDYLRKAVSE ELMEEAGEEV ARRYHLLRSI RRAVKPVHLL       240
     IGGVAGVGKS VLASALAYRL GITRMISTDA VREILRATIP KDLLPTLHTS SFESWRVLAT       300
     PQKAEPSAAL VMQGFRDQVS RVAVGLRAIQ ERSAREKTSL VVEGVHVVPG YMTHQYQHEV       360
     IQIPIMLVLE DEALHRDRFA LRERETGGSR TSGAYAQYFS EIRLIQQHLI ELARGAGVPL       420
     IPAENLDRAI DKGLEVIVDR LQEAYFDVVQ G                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page