(data stored in ACNUC7421 zone)

EMBL: CP001743.PE49

CP001743.PE49        Location/Qualifiers
FT   CDS             42157..42591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0050"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A7BSJ7
FT                   Putative uncharacterized protein; InterPro IPR002716; COGs:
FT                   COG5573 nucleic-acid-binding protein contains PIN domain;
FT                   KEGG: tgr:Tgr7_3220 PilT domain-containing protein; PFAM:
FT                   PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26831"
FT                   /protein_id="ADD26831.1"
FT                   /translation="MKYRYLVDTNLLIYPLDARDPRKQQQAANVLLELVQEGRAALPVQ
FT                   ALSEFASVALRRLEPPLSPQQVGLEVERLMQAFPVLPLTAPVVLEALRGVTQHRLSYYD
FT                   AQVWATARLYQVPLVLSEDFPTGAVLEGVRFLNPLEDALG"
     MKYRYLVDTN LLIYPLDARD PRKQQQAANV LLELVQEGRA ALPVQALSEF ASVALRRLEP        60
     PLSPQQVGLE VERLMQAFPV LPLTAPVVLE ALRGVTQHRL SYYDAQVWAT ARLYQVPLVL       120
     SEDFPTGAVL EGVRFLNPLE DALG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page