(data stored in ACNUC7421 zone)

EMBL: CP001743.PE490

CP001743.PE490       Location/Qualifiers
FT   CDS             complement(484775..485491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0497"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; InterPro
FT                   IPR001387; KEGG: oca:OCAR_4515 transcriptional regulator of
FT                   XRE family; SMART: helix-turn-helix domain protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27272"
FT                   /protein_id="ADD27272.1"
FT                   /translation="MPKKSFRTASLTPENVTPDWGRLLQTRREKLGLSREALALAAGVS
FT                   PSLIAKLEQGNHDLRDVSVGRLHALLRTLHLPSIDFLLGEGPTEEFTPSAPGITPLPYY
FT                   SSLTLACAGEEASTRSHFDTRLLPTRPSYTNFFLAILEQDVLRSEDLSLVEGSVLVVER
FT                   KPARERGIALLGFVEEIRRPLLYRLPPEPRLVRPVSGMGAVYWLLPDGSLQPPSGKKAA
FT                   MYPVPVGVIHGEFRHV"
     MPKKSFRTAS LTPENVTPDW GRLLQTRREK LGLSREALAL AAGVSPSLIA KLEQGNHDLR        60
     DVSVGRLHAL LRTLHLPSID FLLGEGPTEE FTPSAPGITP LPYYSSLTLA CAGEEASTRS       120
     HFDTRLLPTR PSYTNFFLAI LEQDVLRSED LSLVEGSVLV VERKPARERG IALLGFVEEI       180
     RRPLLYRLPP EPRLVRPVSG MGAVYWLLPD GSLQPPSGKK AAMYPVPVGV IHGEFRHV         238
//

If you have problems or comments...

PBIL Back to PBIL home page