(data stored in ACNUC7421 zone)

EMBL: CP001743.PE493

CP001743.PE493       Location/Qualifiers
FT   CDS             486347..487234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV1_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27275"
FT                   /protein_id="ADD27275.1"
FT                   /translation="MAELWPESGARPGKAGICRAVWRGDTHPSLSLFQARGVWFWKDHA
FT                   TGESGNAFHLLLKAGMSKEAAAALLKARAGSGGGAVTHEASIKCRASPRPVRGLTPTER
FT                   RALEAAQQRLDEEAIRGRGITLEQARRVGLGKSRQGDLVIPILGPTGEVQAIKARLREP
FT                   REGFRYRYLTPERGAPAWYSPGFGQDAGRPVIVMEGELNAITSWFALEGRADLLGIPGV
FT                   EGRVPWEGLTGRRVYLYADGDPGGRRAIERWKEEGQAGGVAMFVLEPLEGGLDACEYAA
FT                   RWGQQGLAGQLLQE"
     MAELWPESGA RPGKAGICRA VWRGDTHPSL SLFQARGVWF WKDHATGESG NAFHLLLKAG        60
     MSKEAAAALL KARAGSGGGA VTHEASIKCR ASPRPVRGLT PTERRALEAA QQRLDEEAIR       120
     GRGITLEQAR RVGLGKSRQG DLVIPILGPT GEVQAIKARL REPREGFRYR YLTPERGAPA       180
     WYSPGFGQDA GRPVIVMEGE LNAITSWFAL EGRADLLGIP GVEGRVPWEG LTGRRVYLYA       240
     DGDPGGRRAI ERWKEEGQAG GVAMFVLEPL EGGLDACEYA ARWGQQGLAG QLLQE            295
//

If you have problems or comments...

PBIL Back to PBIL home page