(data stored in ACNUC7421 zone)

EMBL: CP001743.PE495

CP001743.PE495       Location/Qualifiers
FT   CDS             489515..489871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27277"
FT                   /protein_id="ADD27277.1"
FT                   /translation="MSPWGVLLRMVPEVTAKLKGLGCRRLRWLVDGEVVYWALLVPEEA
FT                   DLEAHARFPGMPQQSLEGWLRELLERFEAGWPQARVVEILGVWPDRLERVVRVFPKGPG
FT                   VSLSEECYADPSSG"
     MSPWGVLLRM VPEVTAKLKG LGCRRLRWLV DGEVVYWALL VPEEADLEAH ARFPGMPQQS        60
     LEGWLRELLE RFEAGWPQAR VVEILGVWPD RLERVVRVFP KGPGVSLSEE CYADPSSG         118
//

If you have problems or comments...

PBIL Back to PBIL home page