(data stored in ACNUC7421 zone)

EMBL: CP001743.PE497

CP001743.PE497       Location/Qualifiers
FT   CDS             490168..490416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27279"
FT                   /protein_id="ADD27279.1"
FT                   /translation="MILKLNGMIGEREVFRSYRGLGEWFVRQPNIHTFQAVHRAEDGRE
FT                   TVIGSYASFDEAFWAADRAADEAHQEFVGEAEDGLPF"
     MILKLNGMIG EREVFRSYRG LGEWFVRQPN IHTFQAVHRA EDGRETVIGS YASFDEAFWA        60
     ADRAADEAHQ EFVGEAEDGL PF                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page