(data stored in ACNUC7421 zone)

EMBL: CP001743.PE498

CP001743.PE498       Location/Qualifiers
FT   CDS             490539..491357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_0183 2-oxoglutarate dehydrogenase, E2
FT                   subunit, dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27280"
FT                   /protein_id="ADD27280.1"
FT                   /translation="MKVISYCKQLALVFMLLTPLAMGQSVLKTYYADDLTRVPGVIEVS
FT                   PGFTTVLDFWDTVSTLASAKGELLRVESAGPRILVSATQKAGQTDLVVEVAGRTLLFTL
FT                   KIGPGVGPRRYVIELSRRSSVSAPASAYVPPASPAPSSPAPQAAQPPQSAPLNPEAVRF
FT                   TTTAQVPSDGKGTVTIFFTLENRGNRTLAADPGRLVITQGGNRLSYSLKREPLKTLVNP
FT                   GEALSGLITLEGARAGEIGLEWGLVEIGSGRQFALKRSVMAGTRIELEGR"
     MKVISYCKQL ALVFMLLTPL AMGQSVLKTY YADDLTRVPG VIEVSPGFTT VLDFWDTVST        60
     LASAKGELLR VESAGPRILV SATQKAGQTD LVVEVAGRTL LFTLKIGPGV GPRRYVIELS       120
     RRSSVSAPAS AYVPPASPAP SSPAPQAAQP PQSAPLNPEA VRFTTTAQVP SDGKGTVTIF       180
     FTLENRGNRT LAADPGRLVI TQGGNRLSYS LKREPLKTLV NPGEALSGLI TLEGARAGEI       240
     GLEWGLVEIG SGRQFALKRS VMAGTRIELE GR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page