(data stored in ACNUC7421 zone)

EMBL: CP001743.PE499

CP001743.PE499       Location/Qualifiers
FT   CDS             491411..491920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27281"
FT                   /protein_id="ADD27281.1"
FT                   /translation="MLVEEVLERIPRATFYDLVKRKYLVIVPTVIGRAVVVGPRGRVEV
FT                   LSMTRFYRPRATAVADAVLLRRAIRIAEREGWRFVGRNPRGRIAFMGRNGERLMLIASL
FT                   RAYSTRSLRNTLKRMGWYSRRKQGEAEGVRVYHPYPRRFDRMVKEGGLEVRALSEILPP
FT                   DVDAEE"
     MLVEEVLERI PRATFYDLVK RKYLVIVPTV IGRAVVVGPR GRVEVLSMTR FYRPRATAVA        60
     DAVLLRRAIR IAEREGWRFV GRNPRGRIAF MGRNGERLML IASLRAYSTR SLRNTLKRMG       120
     WYSRRKQGEA EGVRVYHPYP RRFDRMVKEG GLEVRALSEI LPPDVDAEE                   169
//

If you have problems or comments...

PBIL Back to PBIL home page