(data stored in ACNUC7421 zone)

EMBL: CP001743.PE501

CP001743.PE501       Location/Qualifiers
FT   CDS             492439..492729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27283"
FT                   /protein_id="ADD27283.1"
FT                   /translation="MQVADKVVLVTLYPDRPMSGAEAEEWAAGRLQAQLPLEAFEDGKP
FT                   LPPVAVVQEGQTVGFLEGARLLTDTHAGLRLVGVAGRWEGQNVSGMINLDG"
     MQVADKVVLV TLYPDRPMSG AEAEEWAAGR LQAQLPLEAF EDGKPLPPVA VVQEGQTVGF        60
     LEGARLLTDT HAGLRLVGVA GRWEGQNVSG MINLDG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page