(data stored in ACNUC7421 zone)

EMBL: CP001743.PE502

CP001743.PE502       Location/Qualifiers
FT   CDS             492722..493393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27284"
FT                   /protein_id="ADD27284.1"
FT                   /translation="MARGELDQLHNHALNEGVKMMGERYGLEAADGAIIRPTLEAAMEV
FT                   LPLPHQRFVQEHLDYYRRRFSVMEKEGAEAVLVVWSLEEPLVRMMGLGQMPDLVRLPWV
FT                   GSRPLRKDFRDAPVLTRQEALRQIAHILQAEGFTPQEEPVLLPPESDQLAVEVAARLRL
FT                   VAEGRSLEDTARLLVERNRARWEQEGEAPQAVAVVDVGGPLPVMLAFDDPRPLVWGGAV
FT                   A"
     MARGELDQLH NHALNEGVKM MGERYGLEAA DGAIIRPTLE AAMEVLPLPH QRFVQEHLDY        60
     YRRRFSVMEK EGAEAVLVVW SLEEPLVRMM GLGQMPDLVR LPWVGSRPLR KDFRDAPVLT       120
     RQEALRQIAH ILQAEGFTPQ EEPVLLPPES DQLAVEVAAR LRLVAEGRSL EDTARLLVER       180
     NRARWEQEGE APQAVAVVDV GGPLPVMLAF DDPRPLVWGG AVA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page