(data stored in ACNUC7421 zone)

EMBL: CP001743.PE506

CP001743.PE506       Location/Qualifiers
FT   CDS             494934..495611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27288"
FT                   /protein_id="ADD27288.1"
FT                   /translation="MRAELTDLFDRSLSSGVRMVAERYGLEAEAADGALTRPTLEAALE
FT                   AVPPPHQRFMQEHLDYYRRRLSVLEKERAEAALVVWSLEEPLVWLTGIVDMLEVERLPW
FT                   VRGRPLKEGFRDAPPLLTPGETLRQVVHILKAEGYTPREEPRLLPPEPHRLVEVVTPRL
FT                   RVIAQGRTLEESARLVVERTMTRWKEEGECPQAVAVVDVGGPIPVMLAFDDPRPLVWAE
FT                   AGA"
     MRAELTDLFD RSLSSGVRMV AERYGLEAEA ADGALTRPTL EAALEAVPPP HQRFMQEHLD        60
     YYRRRLSVLE KERAEAALVV WSLEEPLVWL TGIVDMLEVE RLPWVRGRPL KEGFRDAPPL       120
     LTPGETLRQV VHILKAEGYT PREEPRLLPP EPHRLVEVVT PRLRVIAQGR TLEESARLVV       180
     ERTMTRWKEE GECPQAVAVV DVGGPIPVML AFDDPRPLVW AEAGA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page