(data stored in ACNUC7421 zone)

EMBL: CP001743.PE508

CP001743.PE508       Location/Qualifiers
FT   CDS             complement(496210..497958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0521 hypothetical protein; SPTR: Q4FX85
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27290"
FT                   /protein_id="ADD27290.1"
FT                   /translation="MRLDPEVKKQVEAALKNPVPPPTDPAFDELLLRLRKENPELADLL
FT                   ESGVLFDDLPTPEEETARAVARRSFFLSLKHRLLDRYDELTGEWVPSRPKQIAVGFLGL
FT                   VVATSLWFALSTRETKAAQGGLPLPVATAPKPTPAPEAPSAPETTQTQAGSTAAQDSPT
FT                   APGSEPGNAQGNAQSSASDSSSVPPPPSGYSEVPPPPSGYPASTPPTGTSTTGGVTQPA
FT                   PPQPLTLYAASPGAVQPASGGSTTAPTTGSNTNTATPASSQPLTLYTGGGSQGAQPLTL
FT                   SRPAAPSASGPSSRPITGSVAEDVAASLQGQPVPSASASASNAPGGGLTLKKETQSTFA
FT                   VRSVEGQGGQGGSFYLVGGPQAQAPVGTPPSAAAPSSVPGFPAQAPAFPPAQPSAPAAA
FT                   ATPPAAPYTLGTRLKGRLGVGVLIAEGTPGAVAIDAEDGSTWVGEVTLDETRRLKGKLT
FT                   RVIKDGREYAVSATLLDAEGTLGVAAKVREEAPSIAADLIRGSLRGVSDYVTAASQAKS
FT                   VTVLPGGGVAQSSQTPPLELFMAGSLANLFALQQDKKAVVRVAQAEKGTEVVILVVPGQ
FT                   DAATGK"
     MRLDPEVKKQ VEAALKNPVP PPTDPAFDEL LLRLRKENPE LADLLESGVL FDDLPTPEEE        60
     TARAVARRSF FLSLKHRLLD RYDELTGEWV PSRPKQIAVG FLGLVVATSL WFALSTRETK       120
     AAQGGLPLPV ATAPKPTPAP EAPSAPETTQ TQAGSTAAQD SPTAPGSEPG NAQGNAQSSA       180
     SDSSSVPPPP SGYSEVPPPP SGYPASTPPT GTSTTGGVTQ PAPPQPLTLY AASPGAVQPA       240
     SGGSTTAPTT GSNTNTATPA SSQPLTLYTG GGSQGAQPLT LSRPAAPSAS GPSSRPITGS       300
     VAEDVAASLQ GQPVPSASAS ASNAPGGGLT LKKETQSTFA VRSVEGQGGQ GGSFYLVGGP       360
     QAQAPVGTPP SAAAPSSVPG FPAQAPAFPP AQPSAPAAAA TPPAAPYTLG TRLKGRLGVG       420
     VLIAEGTPGA VAIDAEDGST WVGEVTLDET RRLKGKLTRV IKDGREYAVS ATLLDAEGTL       480
     GVAAKVREEA PSIAADLIRG SLRGVSDYVT AASQAKSVTV LPGGGVAQSS QTPPLELFMA       540
     GSLANLFALQ QDKKAVVRVA QAEKGTEVVI LVVPGQDAAT GK                          582
//

If you have problems or comments...

PBIL Back to PBIL home page