(data stored in ACNUC7421 zone)

EMBL: CP001743.PE511

CP001743.PE511       Location/Qualifiers
FT   CDS             498649..501186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0518"
FT                   /product="Type IV secretory pathway VirB4 protein"
FT                   /note="SPTR: A3EW83 Putative uncharacterized protein; KEGG:
FT                   ppd:Ppro_0253 sex pilus assembly protein; COGs: COG3451
FT                   Type IV secretory pathway VirB4 protein; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27293"
FT                   /protein_id="ADD27293.1"
FT                   /translation="MTTNSPTSLLNRPRERSLTEEFPYWEIHDGAMFLEDGRCEVGVEL
FT                   LLRPTLLLSQNELEGLLYMVRSVLRNGVPQGARARLVVEAAPAPQETVEAYGRAFDPSH
FT                   PTARFLQNERYRFWSDLWARGQVMTRRAFLTVLYGNKRPRRLPFGKAELAERVKEGGKI
FT                   RERIRMIAKGRGVAVQEMDSQEVFGLAYRYLNPGMRQAGVPRYRPTWQRYPRSAVEKIP
FT                   GLRPPTLRTQLVRSEVDNSHRDALYIGGKWASMFTLYTIPDETYTEMGDVLALAGGGEF
FT                   YLVVDVYHEPYEKALKALKARARRFYAASANTETYVDPNILVGQRETEGAIQHISQTGD
FT                   HVYRVGVALILIEKEREALERRASQVVGRLSEIPGNPFRQLKNGLFEPWKSRAPFSGGM
FT                   SDEVVSLLESNAADLIPLTGAWKGHEKPVALFHNRFLSLTRIDPFTPTTNNWNGIIAGG
FT                   SGSGKTFFTQYILSELLRRNEVDVVILDRGRNYEALVEAFEGAFIDIRPGGETAVNMFD
FT                   LDEGEHTPSPEKLQDVLRFLRAILPAGDDRTEEAVENAILEAAIEQTYKRASPDLPQPD
FT                   GTYRKVYQGARLSDLVQTLVLLDEVGSRPASPSEKEVARKLALRLQSWVGDSPKGQFLD
FT                   RPTSVPLARARVVCYELEGLKDDLEVIGTLLIADLVWKRAKKGQGRRVLVVLDEAWKVF
FT                   QSPYASQLIEELYRRFRFLGGGIWSITQSLADFAGEGPKALLQNTSFHFLLRLSGSDAE
FT                   HAVMRDVLGMPDRAIAVHARLTGVKGVYSEGLAWIRTGEGREGEVIVVRPNPVDYWMFT
FT                   TDKGEVARRRAAVQRYGDVIRAVRALAYGEEKT"
     MTTNSPTSLL NRPRERSLTE EFPYWEIHDG AMFLEDGRCE VGVELLLRPT LLLSQNELEG        60
     LLYMVRSVLR NGVPQGARAR LVVEAAPAPQ ETVEAYGRAF DPSHPTARFL QNERYRFWSD       120
     LWARGQVMTR RAFLTVLYGN KRPRRLPFGK AELAERVKEG GKIRERIRMI AKGRGVAVQE       180
     MDSQEVFGLA YRYLNPGMRQ AGVPRYRPTW QRYPRSAVEK IPGLRPPTLR TQLVRSEVDN       240
     SHRDALYIGG KWASMFTLYT IPDETYTEMG DVLALAGGGE FYLVVDVYHE PYEKALKALK       300
     ARARRFYAAS ANTETYVDPN ILVGQRETEG AIQHISQTGD HVYRVGVALI LIEKEREALE       360
     RRASQVVGRL SEIPGNPFRQ LKNGLFEPWK SRAPFSGGMS DEVVSLLESN AADLIPLTGA       420
     WKGHEKPVAL FHNRFLSLTR IDPFTPTTNN WNGIIAGGSG SGKTFFTQYI LSELLRRNEV       480
     DVVILDRGRN YEALVEAFEG AFIDIRPGGE TAVNMFDLDE GEHTPSPEKL QDVLRFLRAI       540
     LPAGDDRTEE AVENAILEAA IEQTYKRASP DLPQPDGTYR KVYQGARLSD LVQTLVLLDE       600
     VGSRPASPSE KEVARKLALR LQSWVGDSPK GQFLDRPTSV PLARARVVCY ELEGLKDDLE       660
     VIGTLLIADL VWKRAKKGQG RRVLVVLDEA WKVFQSPYAS QLIEELYRRF RFLGGGIWSI       720
     TQSLADFAGE GPKALLQNTS FHFLLRLSGS DAEHAVMRDV LGMPDRAIAV HARLTGVKGV       780
     YSEGLAWIRT GEGREGEVIV VRPNPVDYWM FTTDKGEVAR RRAAVQRYGD VIRAVRALAY       840
     GEEKT                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page